Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.40
PubTator Score 8.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 2.1e-03
malignant mesothelioma 1.500 2.5e-06
medulloblastoma, large-cell 1.100 2.6e-04
osteosarcoma 1.700 1.2e-02
ovarian cancer -1.200 2.6e-05
pancreatic ductal adenocarcinoma liver m... -1.268 5.4e-03

Gene RIF (6)

AA Sequence

MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGK      1 - 70
HHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAAR     71 - 140
SSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKH    141 - 210
LLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGG    211 - 280
RGLSRLEVAALVLGCLIPLILSVGHQH                                               281 - 307
//

Text Mined References (17)

PMID Year Title