Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.10
PubTator Score 8.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma 1.700 0.012
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.268 0.005
diabetes mellitus -1.100 0.002
ovarian cancer 1.900 0.000

Gene RIF (4)

PMID Text
25921144 ZIP9 expression in glioma tumors was not associated with tumor grade or IDH1 mutation status.
25014355 ZIP9 mediates testosterone promotion of apoptosis and is widely expressed in human tissues and up-regulated in malignant breast and prostate tissues, suggesting that it is a potential therapeutic target for treating breast and prostate cancers.
19420709 SLC39A9 functions to regulate zinc homeostasis in the secretory pathway without significantly altering cytosolic zinc homeostasis.
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGK      1 - 70
HHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAAR     71 - 140
SSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKH    141 - 210
LLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGG    211 - 280
RGLSRLEVAALVLGCLIPLILSVGHQH                                               281 - 307
//

Text Mined References (15)

PMID Year Title
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
25014355 2014 Identification and characterization of membrane androgen receptors in the ZIP9 zinc transporter subfamily: II. Role of human ZIP9 in testosterone-induced prostate and breast cancer cell apoptosis.
21696611 2011 Stromal upregulation of lateral epithelial adhesions: gene expression analysis of signalling pathways in prostate epithelium.
19420709 2009 SLC39A9 (ZIP9) regulates zinc homeostasis in the secretory pathway: characterization of the ZIP subfamily I protein in vertebrate cells.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...