Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.54
PubTator Score 4.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.5e-05
ovarian cancer 8520 2.3e-05
psoriasis 6694 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 1.5e-05
ovarian cancer 1.400 2.3e-05
psoriasis 1.400 1.1e-04

Gene RIF (4)

AA Sequence

MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVS      1 - 70
ARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHA     71 - 140
LQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLV    141 - 210
PSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQL    211 - 280
SFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAV    281 - 350
TTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDH    351 - 420
KIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGR    421 - 490
VGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT                        491 - 540
//

Text Mined References (19)

PMID Year Title