Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.83
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 6.33758815150139E-8
osteosarcoma 7933 3.0224082120095E-6
ovarian cancer 8492 5.70775971682197E-6
atypical teratoid / rhabdoid tumor 4369 6.829453282914E-6
medulloblastoma, large-cell 6234 8.59474208209703E-6
lung cancer 4473 5.54349515425231E-5
cutaneous lupus erythematosus 1056 4.1280986964102E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.63883438474194E-4
psoriasis 6685 9.47940415108532E-4
group 3 medulloblastoma 2254 0.00220330032965904
primitive neuroectodermal tumor 3031 0.0470722295385212

Expression

  Differential Expression (11)

Synonym

Accession Q9NUL5 A8MQT9 Q4G188 Q8IYH6 Q8N8V1 RyDEN
Symbols RyDEN

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26735137 we identified a previously uncharacterized gene, C19orf66, as an IFN-stimulated gene (ISG) that inhibits Dengue virus replication

AA Sequence

MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPED      1 - 70
MKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYE     71 - 140
PVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFPVYPTRILPPRWDRDPDRRSTHTHSCSAADC    141 - 210
YNRREPHVPGTSCAHPKSRKQNHLPKVLHPSNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEE    211 - 280
EVEDEEGGPRE                                                               281 - 291
//

Text Mined References (11)

PMID Year Title
26735137 2016 Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...