Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.83
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.177 4.8e-03
atypical teratoid / rhabdoid tumor -1.200 6.8e-06
cutaneous lupus erythematosus 1.600 4.1e-04
group 3 medulloblastoma -1.100 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.500 6.6e-04
lung cancer -1.400 4.3e-03
medulloblastoma, large-cell -1.800 3.8e-06
osteosarcoma -1.927 3.0e-06
ovarian cancer -1.500 2.7e-04
primitive neuroectodermal tumor -1.100 2.6e-02
psoriasis 1.500 9.5e-04

Gene RIF (2)

AA Sequence

MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPED      1 - 70
MKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYE     71 - 140
PVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFPVYPTRILPPRWDRDPDRRSTHTHSCSAADC    141 - 210
YNRREPHVPGTSCAHPKSRKQNHLPKVLHPSNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEE    211 - 280
EVEDEEGGPRE                                                               281 - 291
//

Text Mined References (12)

PMID Year Title