Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.82
PubTator Score 9.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.23880590533846E-9
osteosarcoma 7933 2.92546391442657E-7
pilocytic astrocytoma 3086 2.93303500370095E-7
medulloblastoma 1524 7.00078431609141E-7
pediatric high grade glioma 2712 7.41319099225871E-7
glioblastoma 5572 1.63850468179734E-6
medulloblastoma, large-cell 6234 8.42144120525893E-5
primitive neuroectodermal tumor 3031 8.98692208719801E-5
lung cancer 4473 6.72753103246916E-4
astrocytoma 1493 0.00106349563724375
ependymoma 2514 0.004483537354651
oligodendroglioma 2849 0.00669657999355571
ovarian cancer 8492 0.0136872030168656
invasive ductal carcinoma 2950 0.0142171387117331
non primary Sjogren syndrome sicca 840 0.0289842579276831
Disease Target Count Z-score Confidence
Microphthalmia 79 3.465 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.700 0.001
ependymoma -2.000 0.004
oligodendroglioma -1.500 0.007
glioblastoma -2.200 0.000
osteosarcoma -2.722 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.600 0.000
lung cancer 1.200 0.001
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.029
invasive ductal carcinoma 1.200 0.014
ovarian cancer 1.200 0.014

Gene

  Ortholog (6)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

Pathway (1)

Gene RIF (7)

PMID Text
24520823 Authors establish that human Staufen-2, a host factor which is up-regulated upon HIV-1 infection, interacts with HIV-1 Rev, thereby promoting its RNA export activity and progeny virus formation.
24520823 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
23263869 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
21508097 We suggest a role for Stau2 in the generation and regulation of Map1b mRNA containing granules that are required for mGluR-long-term depression
18094122 Stau1- and Stau2-mRNPs associate with distinct but overlapping sets of cellular mRNAs.
15024055 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
12140260 Data show that Stau2 is localized to the neuronal soma and dendrites, but it does not colocalize with Stau1-containing particles.

AA Sequence

MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKAL      1 - 70
TESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHC     71 - 140
PVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDMDDDKDANKSEIS    141 - 210
LVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPV    211 - 280
VEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEV    281 - 350
ATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY    351 - 420
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPP    421 - 490
CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIA    491 - 560
QDCKKSNSAV                                                                561 - 570
//

Text Mined References (30)

PMID Year Title
24520823 2014 Human protein Staufen-2 promotes HIV-1 proliferation by positively regulating RNA export activity of viral protein Rev.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23263869 2013 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21508097 2011 Staufen 2 regulates mGluR long-term depression and Map1b mRNA distribution in hippocampal neurons.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...