Property Summary

NCBI Gene PubMed Count 18
Grant Count 10
R01 Count 5
Funding $550,006.37
PubMed Score 18.82
PubTator Score 9.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.700 0.001
ependymoma -2.000 0.004
oligodendroglioma -1.500 0.007
glioblastoma -2.200 0.000
osteosarcoma -2.722 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.600 0.000
lung cancer 1.200 0.001
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.029
invasive ductal carcinoma 1.200 0.014
ovarian cancer 1.200 0.014

 GO Process (1)

Gene RIF (9)

PMID Text
24520823 Authors establish that human Staufen-2, a host factor which is up-regulated upon HIV-1 infection, interacts with HIV-1 Rev, thereby promoting its RNA export activity and progeny virus formation.
24520823 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
24520823 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
23263869 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
21508097 We suggest a role for Stau2 in the generation and regulation of Map1b mRNA containing granules that are required for mGluR-long-term depression
18094122 Stau1- and Stau2-mRNPs associate with distinct but overlapping sets of cellular mRNAs.
15024055 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
15024055 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
12140260 Data show that Stau2 is localized to the neuronal soma and dendrites, but it does not colocalize with Stau1-containing particles.

AA Sequence

MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKAL      1 - 70
TESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHC     71 - 140
PVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDMDDDKDANKSEIS    141 - 210
LVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPV    211 - 280
VEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEV    281 - 350
ATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY    351 - 420
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPP    421 - 490
CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIA    491 - 560
QDCKKSNSAV                                                                561 - 570
//

Text Mined References (30)

PMID Year Title
24520823 2014 Human protein Staufen-2 promotes HIV-1 proliferation by positively regulating RNA export activity of viral protein Rev.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23263869 2013 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21508097 2011 Staufen 2 regulates mGluR long-term depression and Map1b mRNA distribution in hippocampal neurons.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...