Property Summary

NCBI Gene PubMed Count 20
PubMed Score 21.63
PubTator Score 9.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 2.0e-04
astrocytic glioma -1.500 4.7e-03
Astrocytoma, Pilocytic -1.700 2.8e-07
atypical teratoid / rhabdoid tumor -1.800 2.0e-07
ependymoma -2.000 4.5e-03
glioblastoma -1.700 4.4e-08
group 3 medulloblastoma 1.200 9.5e-04
invasive ductal carcinoma 1.200 1.4e-02
lung cancer 1.200 6.7e-04
medulloblastoma, large-cell -1.300 1.4e-03
non primary Sjogren syndrome sicca -1.100 2.9e-02
oligodendroglioma -1.200 2.2e-02
osteosarcoma -1.143 8.1e-05
ovarian cancer 1.100 6.1e-03
primitive neuroectodermal tumor -1.600 9.0e-05

 GO Process (1)

Gene RIF (8)

AA Sequence

MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKAL      1 - 70
TESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHC     71 - 140
PVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDMDDDKDANKSEIS    141 - 210
LVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPV    211 - 280
VEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEV    281 - 350
ATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY    351 - 420
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPP    421 - 490
CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIA    491 - 560
QDCKKSNSAV                                                                561 - 570
//

Text Mined References (32)

PMID Year Title