Property Summary

NCBI Gene PubMed Count 15
Grant Count 25
R01 Count 10
Funding $2,248,921.65
PubMed Score 18.02
PubTator Score 12.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
19095965 MBNL3 was not found in human samples.
17102799 We exclude MBNL3 as the causative gene in this family.
15257297 MBNL proteins promote opposite splicing patterns for cardiac troponin T and insulin receptor alternative exons
12297108 results suggest that CHCR is an inhibitor of myogenesis

AA Sequence

MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL      1 - 70
HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM     71 - 140
GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD    141 - 210
NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT    211 - 280
PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN    281 - 350
QLKF                                                                      351 - 354
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19095965 2009 Muscleblind-like proteins: similarities and differences in normal and myotonic dystrophy muscle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17102799 2006 Fine mapping of the X-linked recessive congenital idiopathic nystagmus locus at Xq24-q26.3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...