Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.80
PubTator Score 12.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 2.100 3.0e-05
Astrocytoma, Pilocytic 2.100 1.3e-06
atypical teratoid / rhabdoid tumor 1.500 3.1e-02
Breast cancer -1.600 7.5e-04
ependymoma 1.600 4.3e-07
glioblastoma 1.400 7.4e-04
medulloblastoma, large-cell 2.600 1.6e-06
osteosarcoma -2.006 1.4e-02
ovarian cancer -2.000 9.0e-10
pancreatic ductal adenocarcinoma liver m... -2.214 4.8e-04
pituitary cancer 1.100 6.7e-04
primitive neuroectodermal tumor 1.500 3.6e-02
sonic hedgehog group medulloblastoma 1.200 3.0e-03
subependymal giant cell astrocytoma 1.413 4.5e-02
tuberculosis 1.200 2.4e-06

Gene RIF (5)

AA Sequence

MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL      1 - 70
HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM     71 - 140
GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD    141 - 210
NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT    211 - 280
PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN    281 - 350
QLKF                                                                      351 - 354
//

Text Mined References (17)

PMID Year Title