Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.80
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.200 2.2e-02
malignant mesothelioma 4.300 7.4e-10
osteosarcoma -2.178 2.6e-06
pituitary cancer 1.100 1.4e-04
psoriasis 1.100 9.2e-07
subependymal giant cell astrocytoma -2.173 6.7e-03

Synonym

Accession Q9NUJ7 A2BH51 A2BH52
Symbols LL0XNC01-136G2.1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN      1 - 70
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW     71 - 140
LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR    141 - 210
HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL    211 - 280
SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC                               281 - 323
//

Text Mined References (10)

PMID Year Title