Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.71
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 4.300 0.000
psoriasis 1.700 0.000
osteosarcoma -2.178 0.000
breast carcinoma 1.200 0.022
subependymal giant cell astrocytoma -2.173 0.007
pituitary cancer 1.100 0.000

AA Sequence

MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN      1 - 70
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW     71 - 140
LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR    141 - 210
HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL    211 - 280
SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC                               281 - 323
//

Text Mined References (10)

PMID Year Title
22732399 2012 Cloning, tissue distribution and sub-cellular localisation of phospholipase C X-domain containing protein (PLCXD) isoforms.
20016163 2009 Characterization of the bovine pseudoautosomal region and comparison with sheep, goat, and other mammalian pseudoautosomal regions.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.