Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.23395432166147E-8
osteosarcoma 7933 4.65398486566283E-5
medulloblastoma 1524 0.00297507646931608
ependymoma 2514 0.00389629814999562
astrocytic glioma 2241 0.00541144427609171
ovarian cancer 8492 0.00567919258343501
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00571689783103814
medulloblastoma, large-cell 6234 0.00870979160119292
Disease Target Count Z-score Confidence
Cryptorchidism 67 3.629 1.8
Azoospermia 89 3.433 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
astrocytic glioma -1.500 0.005
ependymoma -2.000 0.004
osteosarcoma -1.060 0.000
medulloblastoma -1.100 0.003
medulloblastoma, large-cell -1.200 0.009
intraductal papillary-mucinous adenoma (... -1.100 0.006
ovarian cancer 1.300 0.006

Synonym

Accession Q9NUJ3 D3DR01 Q8IVX4
Symbols dJ85M6.3

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETA      1 - 70
RGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET     71 - 140
LLSFLLPGHTRLRNQITEVLDLDLIKQEAENGALDISKLAEFIIGMMGTLCAPARDEEVKKLKDIKEIVP    141 - 210
LFREIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERKKFQEILERQPNSLDFVTQWLEEASEDLMTQKY    211 - 280
KHALPVGGMAAGSGDMPRLSPVAVQNYAYLKLLKWDHLQRPFPETVLMDQSRFHELQLQLEQLTILGAVL    281 - 350
LVTFSMAAPGISSQADFAEKLKMIVKILLTDMHLPSFHLKDVLTTIGEKVCLEVSSCLSLCGSSPFTTDK    351 - 420
ETVLKGQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRELEEVAIKFARLVNYN    421 - 490
KMVFCPYYDAILSKILVRS                                                       491 - 509
//

Text Mined References (12)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
20205591 2010 Host determinants of HIV-1 control in African Americans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...