Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
astrocytic glioma -1.500 0.005
ependymoma -2.000 0.004
osteosarcoma -1.060 0.000
medulloblastoma -1.100 0.003
medulloblastoma, large-cell -1.200 0.009
intraductal papillary-mucinous adenoma (... -1.100 0.006
ovarian cancer 1.300 0.006

Gene RIF (1)

PMID Text
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETA      1 - 70
RGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET     71 - 140
LLSFLLPGHTRLRNQITEVLDLDLIKQEAENGALDISKLAEFIIGMMGTLCAPARDEEVKKLKDIKEIVP    141 - 210
LFREIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERKKFQEILERQPNSLDFVTQWLEEASEDLMTQKY    211 - 280
KHALPVGGMAAGSGDMPRLSPVAVQNYAYLKLLKWDHLQRPFPETVLMDQSRFHELQLQLEQLTILGAVL    281 - 350
LVTFSMAAPGISSQADFAEKLKMIVKILLTDMHLPSFHLKDVLTTIGEKVCLEVSSCLSLCGSSPFTTDK    351 - 420
ETVLKGQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRELEEVAIKFARLVNYN    421 - 490
KMVFCPYYDAILSKILVRS                                                       491 - 509
//

Text Mined References (12)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
20205591 2010 Host determinants of HIV-1 control in African Americans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...