Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.81
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.53769638077536E-21
osteosarcoma 7933 3.07600455278956E-4
lung cancer 4473 4.09257670932325E-4
group 4 medulloblastoma 1875 5.31635381632727E-4
Pick disease 1893 5.5656526542654E-4
primary pancreatic ductal adenocarcinoma 1271 8.72676776765102E-4
Waldenstrons macroglobulinemia 765 0.00362485516641492
psoriasis 6685 0.00797377873387406
ovarian cancer 8492 0.0110642138191775
aldosterone-producing adenoma 664 0.0483659599157934
Disease Target Count Z-score Confidence
Methemoglobinemia 17 4.461 2.2

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.129 0.004
psoriasis -1.100 0.008
osteosarcoma -1.343 0.000
primary pancreatic ductal adenocarcinoma -1.166 0.001
lung cancer 1.200 0.000
group 4 medulloblastoma 1.100 0.001
aldosterone-producing adenoma -1.038 0.048
lung carcinoma 1.300 0.000
Pick disease -1.200 0.001
ovarian cancer 1.100 0.011

Synonym

Accession Q9NUJ1 B7Z6A8 C9IZX5 D3DN63 Q8TCF9
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
463149 other 3 / 0 / 21 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (5)

PMID Text
25217485 Which potently inhibited ABHD10 activity.
22294686 ABHD10 is responsible for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.
21078990 mitochondrial localization of rat Abhd10
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKK      1 - 70
LKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDD     71 - 140
LADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYS    141 - 210
EEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHR    211 - 280
MREKADIQLLVYTIDDLIDKLSTIVN                                                281 - 306
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25217485 2014 An orphan esterase ABHD10 modulates probenecid acyl glucuronidation in human liver.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22813719 2012 The emerging role of human esterases.
22400490 2012 Competitive activity-based protein profiling identifies aza-?-lactams as a versatile chemotype for serine hydrolase inhibition.
22294686 2012 Human ?/? hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.
21269460 2011 Initial characterization of the human central proteome.
21078990 2010 ALS-linked mutant superoxide dismutase 1 (SOD1) alters mitochondrial protein composition and decreases protein import.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...