Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.89
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.038 4.8e-02
group 4 medulloblastoma 1.100 5.3e-04
lung cancer 1.200 4.1e-04
lung carcinoma 1.300 1.5e-21
osteosarcoma -1.343 3.1e-04
ovarian cancer 1.100 1.1e-02
pancreatic ductal adenocarcinoma liver m... -1.091 1.3e-03
Pick disease -1.200 5.6e-04
psoriasis -1.100 8.0e-03
Waldenstrons macroglobulinemia 1.129 3.6e-03

Gene RIF (5)

AA Sequence

MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKK      1 - 70
LKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDD     71 - 140
LADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYS    141 - 210
EEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHR    211 - 280
MREKADIQLLVYTIDDLIDKLSTIVN                                                281 - 306
//

Text Mined References (19)

PMID Year Title