Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.81
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.129 0.004
psoriasis -1.100 0.008
osteosarcoma -1.343 0.000
primary pancreatic ductal adenocarcinoma -1.166 0.001
lung cancer 1.200 0.000
group 4 medulloblastoma 1.100 0.001
aldosterone-producing adenoma -1.038 0.048
lung carcinoma 1.300 0.000
Pick disease -1.200 0.001
ovarian cancer 1.100 0.011

Synonym

Accession Q9NUJ1 B7Z6A8 C9IZX5 D3DN63 Q8TCF9
Symbols

Gene

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
463149 other 3 / 0 / 21 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (5)

PMID Text
25217485 Which potently inhibited ABHD10 activity.
22294686 ABHD10 is responsible for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.
21078990 mitochondrial localization of rat Abhd10
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKK      1 - 70
LKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDD     71 - 140
LADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYS    141 - 210
EEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHR    211 - 280
MREKADIQLLVYTIDDLIDKLSTIVN                                                281 - 306
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25217485 2014 An orphan esterase ABHD10 modulates probenecid acyl glucuronidation in human liver.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22813719 2012 The emerging role of human esterases.
22400490 2012 Competitive activity-based protein profiling identifies aza-?-lactams as a versatile chemotype for serine hydrolase inhibition.
22294686 2012 Human ?/? hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.
21269460 2011 Initial characterization of the human central proteome.
21078990 2010 ALS-linked mutant superoxide dismutase 1 (SOD1) alters mitochondrial protein composition and decreases protein import.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...