Property Summary

NCBI Gene PubMed Count 12
Grant Count 41
R01 Count 5
Funding $29,601,959
PubMed Score 21.92
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.900 0.000
lung adenocarcinoma 1.600 0.000
ovarian cancer -1.300 0.000

AA Sequence

MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAAR      1 - 70
KLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSG     71 - 140
TFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGP    141 - 210
ISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVK    211 - 280
GLPDFASFSAKL                                                              281 - 292
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745130 2012 Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal ?-oxidation of unsaturated fatty acids.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...