Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.92
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 5.28153073525629E-11
ovarian cancer 8492 7.35442370634504E-8
psoriasis 6685 5.5190660389347E-5
Disease Target Count Z-score Confidence
Excessive tearing 5 3.868 1.9
Dacryocystitis 7 3.855 1.9
Zellweger Syndrome 38 3.266 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.900 0.000
lung adenocarcinoma 1.600 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9NUI1 Q6ZRS7 Q96ET0 pDCR
Symbols PDCR
SDR17C1

Gene

PANTHER Protein Class (2)

PDB

4FC6   4FC7  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAAR      1 - 70
KLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSG     71 - 140
TFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGP    141 - 210
ISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVK    211 - 280
GLPDFASFSAKL                                                              281 - 292
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745130 2012 Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal ?-oxidation of unsaturated fatty acids.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...