Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.0e-04
Breast cancer 3578 3.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.400 3.1e-02
ovarian cancer -1.400 7.0e-04

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAAT      1 - 70
SVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD                               71 - 114
//

Text Mined References (7)

PMID Year Title