Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.96
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count P-value
adrenocortical carcinoma 1428 5.0e-04
acute myeloid leukemia 783 4.5e-02

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 4.5e-02
adrenocortical carcinoma 1.096 5.0e-04

Synonym

Accession Q9NUG6 B2R511 Q96GP3 Q9BUW8
Symbols PDRG
C20orf126

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH      1 - 70
PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG            71 - 133
//

Text Mined References (14)

PMID Year Title