Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $71,220.84
PubMed Score 6.96
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma 1.096 0.001
acute myeloid leukemia 1.200 0.045

Gene RIF (4)

PMID Text
25706919 PDRG1 was significantly increased in tumors low of miR-214.
21193842 PDRG1 expression is increased in multiple human malignancies suggesting it to be a high-value novel tumor marker that could play a role in cancer development and/or progression.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
14562055 Cloning and characterization of a novel gene PDRG that is differentially regulated by p53 and ultraviolet radiation

AA Sequence

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH      1 - 70
PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG            71 - 133
//

Text Mined References (11)

PMID Year Title
25706919 2015 MicroRNA-214 suppresses oncogenesis and exerts impact on prognosis by targeting PDRG1 in bladder cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21193842 2011 PDRG1, a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562055 2003 Cloning and characterization of a novel gene PDRG that is differentially regulated by p53 and ultraviolet radiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...