Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.23241326514917E-30
lung adenocarcinoma 2714 7.98010742786473E-18
interstitial cystitis 2299 8.22032603049387E-6
ductal carcinoma in situ 1745 0.00182298128501685
invasive ductal carcinoma 2950 0.00248053347581746

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -2.500 0.000
interstitial cystitis 1.200 0.000
lung adenocarcinoma -1.700 0.000
ductal carcinoma in situ -1.400 0.002
invasive ductal carcinoma -1.800 0.002

Synonym

Accession Q9NUG4 Q5JYR9 Q8N5F1 Q8N6G8 Q96MD5 CCM2-like
Symbols C20orf160
dJ310O13.5

Gene

  Ortholog (10)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish EggNOG Inparanoid

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEYEVKKGKKGFVSPIRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGH      1 - 70
LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHEIAAA     71 - 140
SYLQDDALHLLVLKTGLGVDPVPAGVDASPGGAGRDPGPPGGAPEKRRVGTAERRHTICSLDWRMGWGGG    141 - 210
AAEARAGGGGGGSLERQRAGARASGSWERRQTFSGSWERRHGGGGGGGGAGKPGGSWERRQAGSGGGGSW    211 - 280
ERRHPGPNPLDPQDPSPDAYCNLVILAVANRDAAEESCALICQVFQIIYGDQSIECVDRAGYHYTSTPER    281 - 350
PWLCSRSESCHTDGTYAYDADFSCCSSFNGSQDTFEACYSGTSTPSFHGSHCSGSDHSSLGLEQLQDYMV    351 - 420
TLRSKLGPLEIQQFAMLLREYRLGLPIQDYCTGLLKLYGDRRKFLLLGMRPFIPDQDIGYFEGFLEGVGI    421 - 490
REGGILTDSFGRIKRSMSSTSASAVRSYDGAAQRPEAQAFHRLLADITHDIEALAPDDDDDDEDEPRGSR    491 - 560
GGSDAAEDNYL                                                               561 - 571
//

Text Mined References (7)

PMID Year Title
22898778 2012 Dynamic regulation of the cerebral cavernous malformation pathway controls vascular stability and growth.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.