Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hemangioma 69 4.026 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ -1.400 1.8e-03
interstitial cystitis 1.200 8.2e-06
invasive ductal carcinoma -1.800 2.5e-03
lung adenocarcinoma -1.700 8.0e-18
non-small cell lung cancer -2.500 1.2e-30

Synonym

Accession Q9NUG4 Q5JYR9 Q8N5F1 Q8N6G8 Q96MD5 CCM2-like
Symbols C20orf160
dJ310O13.5

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MEYEVKKGKKGFVSPIRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGH      1 - 70
LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHEIAAA     71 - 140
SYLQDDALHLLVLKTGLGVDPVPAGVDASPGGAGRDPGPPGGAPEKRRVGTAERRHTICSLDWRMGWGGG    141 - 210
AAEARAGGGGGGSLERQRAGARASGSWERRQTFSGSWERRHGGGGGGGGAGKPGGSWERRQAGSGGGGSW    211 - 280
ERRHPGPNPLDPQDPSPDAYCNLVILAVANRDAAEESCALICQVFQIIYGDQSIECVDRAGYHYTSTPER    281 - 350
PWLCSRSESCHTDGTYAYDADFSCCSSFNGSQDTFEACYSGTSTPSFHGSHCSGSDHSSLGLEQLQDYMV    351 - 420
TLRSKLGPLEIQQFAMLLREYRLGLPIQDYCTGLLKLYGDRRKFLLLGMRPFIPDQDIGYFEGFLEGVGI    421 - 490
REGGILTDSFGRIKRSMSSTSASAVRSYDGAAQRPEAQAFHRLLADITHDIEALAPDDDDDDEDEPRGSR    491 - 560
GGSDAAEDNYL                                                               561 - 571
//

Text Mined References (7)

PMID Year Title