Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.45903236307949E-6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.685 0.000

Synonym

Accession Q9NUD7 A3KPE0 B2RPH9 Q8N840 Q8NAX5
Symbols dJ1103G7.2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

AA Sequence

MAHVLQKPKHSGTHSIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTT      1 - 70
VVTSCQPKNPRELHRRRKLDPGKMHAKIWLMKTSLRSGRAALRELRSRENFLSKLNRELIETIQEMENST     71 - 140
TLHVRALLQQQDTLATIIDILEYSNKKRLQQLKSELQEWEEKKKCKMSYLEQQAEQLNAKIEKTQEEVNF    141 - 210
LSTYMDHEYSIKSVQISTLMRQLQQVKDSQQDELDDLGEMRRKVLESLSDKIQKKKKKILSSVVAETQRP    211 - 280
YEEALLQKMWESQDFLKCMQRFREIIDQFEENMPVLRAEVEELQAQTREPREVIFEDVLLRRPKCTPDMD    281 - 350
VILNIPVEEPLPF                                                             351 - 363
//

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.