Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.200 0.010
ependymoma -1.300 0.021
oligodendroglioma -1.200 0.017
osteosarcoma -1.792 0.049
sonic hedgehog group medulloblastoma 2.100 0.000
cystic fibrosis -1.959 0.000
intraductal papillary-mucinous adenoma (... 2.500 0.009
intraductal papillary-mucinous neoplasm ... 2.300 0.047
Breast cancer 3.200 0.025
psoriasis 1.100 0.000
lung carcinoma -1.600 0.000
ductal carcinoma in situ 1.200 0.011
invasive ductal carcinoma 1.200 0.013

Synonym

Accession Q9NUC0 B2RD32
Symbols DJ667H12.2

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MTLVLSMNRFCEPIVSEGAAEIAGYQTLWEADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPIT      1 - 70
TSKITYFKRKYVEEEDFHPPLSSCSHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIH     71 - 140
GEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANV    141 - 210
GSASTAASSPSASSSSSSSSSSPPLPLPSCSRQVDFDVGSASIYKSDGQIPANEIFVTNVRSLGVQEKAK    211 - 280
LNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCC    281 - 350
SKGSKI                                                                    351 - 356
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.