Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.25028076487895E-15
psoriasis 6685 6.04014030562194E-14
sonic hedgehog group medulloblastoma 1482 1.02695242283031E-6
cystic fibrosis 1670 1.64917947451155E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00889004885005578
astrocytic glioma 2241 0.0101391599321779
ductal carcinoma in situ 1745 0.0106849759876775
invasive ductal carcinoma 2950 0.0134618864187845
oligodendroglioma 2849 0.0173531615759277
ependymoma 2514 0.0207887524232863
Breast cancer 3099 0.0250850779809415
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0467761553588373
osteosarcoma 7933 0.0488886980091195

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.200 0.010
ependymoma -1.300 0.021
oligodendroglioma -1.200 0.017
osteosarcoma -1.792 0.049
sonic hedgehog group medulloblastoma 2.100 0.000
cystic fibrosis -1.959 0.000
intraductal papillary-mucinous adenoma (... 2.500 0.009
intraductal papillary-mucinous neoplasm ... 2.300 0.047
Breast cancer 3.200 0.025
psoriasis 1.100 0.000
lung carcinoma -1.600 0.000
ductal carcinoma in situ 1.200 0.011
invasive ductal carcinoma 1.200 0.013

Synonym

Accession Q9NUC0 B2RD32
Symbols DJ667H12.2

Gene

  Ortholog (10)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MTLVLSMNRFCEPIVSEGAAEIAGYQTLWEADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPIT      1 - 70
TSKITYFKRKYVEEEDFHPPLSSCSHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIH     71 - 140
GEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANV    141 - 210
GSASTAASSPSASSSSSSSSSSPPLPLPSCSRQVDFDVGSASIYKSDGQIPANEIFVTNVRSLGVQEKAK    211 - 280
LNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCC    281 - 350
SKGSKI                                                                    351 - 356
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.