Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.37
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.200 1.0e-02
Breast cancer 3.200 2.5e-02
cystic fibrosis -1.286 2.1e-05
ductal carcinoma in situ 1.200 1.1e-02
ependymoma -1.300 2.1e-02
group 3 medulloblastoma 1.700 9.1e-03
intraductal papillary-mucinous adenoma (... 2.500 8.9e-03
intraductal papillary-mucinous neoplasm ... 2.300 4.7e-02
invasive ductal carcinoma 1.100 2.6e-03
lung carcinoma -1.600 1.3e-15
oligodendroglioma -1.200 1.7e-02
osteosarcoma -1.792 4.9e-02
psoriasis 1.100 6.0e-14

AA Sequence

MTLVLSMNRFCEPIVSEGAAEIAGYQTLWEADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPIT      1 - 70
TSKITYFKRKYVEEEDFHPPLSSCSHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIH     71 - 140
GEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANV    141 - 210
GSASTAASSPSASSSSSSSSSSPPLPLPSCSRQVDFDVGSASIYKSDGQIPANEIFVTNVRSLGVQEKAK    211 - 280
LNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCC    281 - 350
SKGSKI                                                                    351 - 356
//

Text Mined References (5)

PMID Year Title