Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.81
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
medulloblastoma, large-cell 6241 6.2e-05
osteosarcoma 7950 3.2e-04
lung cancer 4740 6.3e-04
group 3 medulloblastoma 4104 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Osteoporosis 363 3.698 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-02
lung cancer 1.400 6.3e-04
medulloblastoma, large-cell 1.100 6.2e-05
osteosarcoma -1.207 3.2e-04

Gene RIF (4)

AA Sequence

MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTISIDASVVSPEE      1 - 70
FALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCSVQGQVVRDVSAPSSETFRKE     71 - 140
PEKPQVEILSSEGAGEPHSSPELAATPGGPVKAETEEAAHSVSQEMSVNSPTAQESQRNAETPAETPTTA    141 - 210
EACSPSPAVQTFSEAKKTSTEPGCERKHYQLNFLLENEGVFSDALMVTQDVLKKLEMCSEIKGPQKEMIV    211 - 280
KCFEGEGGHSAFQRILGKVREESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQPKGSTEEGKTL    281 - 350
SVLLLEHKEDLIQCVTQLRPIMESLETAKEEFLTGTEKRVILNCCEGRTPKETIENLLHRMTEEKTLTAE    351 - 420
GLVKLLQAVKTTFPNLGLLLEKLQKSATLPSTTVQPSPDDYGTELLRRYHENLSEIFTDNQILLKMISHM    421 - 490
TSLAPGEREVMEKLVKRDSGSGGFNSLISAVLEKQTLSATAIWQLLLVVQETKTCPLDLLMEEIRREPGA    491 - 560
DAFFRAVTTPEHATLETILRHNQLILEAIQQKIEYKLFTSEEEHLAETVKEILSIPSETASPEASLRAVL    561 - 630
SRAMEKSVPAIEICHLLCSVHKSFPGLQPVMQELAYIGVLTKEDGEKETWKVSNKFHLEANNKEDEKAAK    631 - 700
EDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKE    701 - 770
CSETKDSKKELDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEE    771 - 840
CGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDAVFAQSIELSR    841 - 910
HVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQDHRKHIHEVHSKEYHPC    911 - 980
PTCGKIFSAPSMLERHVVTHVGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSLQCSS    981 - 1050
CDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQ   1051 - 1120
HHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVI   1121 - 1190
TLEETQLAGSQVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK                        1191 - 1239
//

Text Mined References (21)

PMID Year Title