Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.81
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.207 0.000
medulloblastoma, large-cell 1.100 0.000
lung cancer 1.400 0.001
group 3 medulloblastoma 1.700 0.000

Gene RIF (4)

PMID Text
22824048 Opposite associations of osteoprotegerin and ZBTB40 polymorphisms with bone mineral density of the hip in postmenopausal Taiwanese women.
20554715 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18445777 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTISIDASVVSPEE      1 - 70
FALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCSVQGQVVRDVSAPSSETFRKE     71 - 140
PEKPQVEILSSEGAGEPHSSPELAATPGGPVKAETEEAAHSVSQEMSVNSPTAQESQRNAETPAETPTTA    141 - 210
EACSPSPAVQTFSEAKKTSTEPGCERKHYQLNFLLENEGVFSDALMVTQDVLKKLEMCSEIKGPQKEMIV    211 - 280
KCFEGEGGHSAFQRILGKVREESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQPKGSTEEGKTL    281 - 350
SVLLLEHKEDLIQCVTQLRPIMESLETAKEEFLTGTEKRVILNCCEGRTPKETIENLLHRMTEEKTLTAE    351 - 420
GLVKLLQAVKTTFPNLGLLLEKLQKSATLPSTTVQPSPDDYGTELLRRYHENLSEIFTDNQILLKMISHM    421 - 490
TSLAPGEREVMEKLVKRDSGSGGFNSLISAVLEKQTLSATAIWQLLLVVQETKTCPLDLLMEEIRREPGA    491 - 560
DAFFRAVTTPEHATLETILRHNQLILEAIQQKIEYKLFTSEEEHLAETVKEILSIPSETASPEASLRAVL    561 - 630
SRAMEKSVPAIEICHLLCSVHKSFPGLQPVMQELAYIGVLTKEDGEKETWKVSNKFHLEANNKEDEKAAK    631 - 700
EDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKE    701 - 770
CSETKDSKKELDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEE    771 - 840
CGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDAVFAQSIELSR    841 - 910
HVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQDHRKHIHEVHSKEYHPC    911 - 980
PTCGKIFSAPSMLERHVVTHVGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSLQCSS    981 - 1050
CDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQ   1051 - 1120
HHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVI   1121 - 1190
TLEETQLAGSQVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK                        1191 - 1239
//

Text Mined References (20)

PMID Year Title
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22824048 2012 Opposite associations of osteoprotegerin and ZBTB40 polymorphisms with bone mineral density of the hip in postmenopausal Taiwanese women.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21533022 2011 Genome-wide association study using extreme truncate selection identifies novel genes affecting bone mineral density and fracture risk.
20554715 2010 Analysis of recently identified osteoporosis susceptibility genes in Han Chinese women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...