Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma -1.052 3.8e-02
Breast cancer 3.000 3.4e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.7e-03
osteosarcoma 1.888 2.8e-06

Synonym

Accession Q9NU53 B2RDY7 E1P5A2
Symbols C6orf72

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEGAPPGSLALRLLLFVALPASGWLTTGAPEPPPLSGAPQDGIRINVTTLKDDGDISKQQVVLNITYESG      1 - 70
QVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEID     71 - 140
GKQVQQKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIR    141 - 210
NVETTVDEDVLPGKLPETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSNVFPVFFQFLNIMVVGITGAAVV    211 - 280
ITILKVFFPVSEYKGILQLDKVDVIPVTAINLYPDGPEKRAENLEDKTCI                        281 - 330
//

Text Mined References (6)

PMID Year Title