Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $40,833.33
PubMed Score 4.89
PubTator Score 2.56

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWGGVALP      1 - 70
REHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGR     71 - 140
FPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGSFLRRRKRFKRHQLTP    141 - 210
GAHLPHPFPLPAAHAALHNPRPGPLLGAPALPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGA    211 - 280
PKKAEGADLATPGTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWS    281 - 350
YCPLLQRPSSLSDNFAATAAASGGGLRQRLRSHQGRGAGRAPVGRVGAAAVSGGGRGL                351 - 408
//

Text Mined References (8)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15233989 2004 Diverse fates of paralogs following segmental duplication of telomeric genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421752 2002 Gene content and function of the ancestral chromosome fusion site in human chromosome 2q13-2q14.1 and paralogous regions.
7957066 1994 Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.