Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.1e-03
osteosarcoma -1.659 7.9e-07
ovarian cancer 1.100 6.4e-07
psoriasis -2.600 2.2e-05
subependymal giant cell astrocytoma 1.882 6.8e-03

Synonym

Accession Q9NU23 B2R4U2 E1P517
Symbols DJ122O8.2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMIT      1 - 70
QGNMQLKELEKTLALAKS                                                         71 - 88
//

Text Mined References (10)

PMID Year Title