Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.600 0.000
osteosarcoma -1.659 0.000
medulloblastoma, large-cell 1.200 0.001
subependymal giant cell astrocytoma 1.882 0.007
ovarian cancer 1.100 0.000

Synonym

Accession Q9NU23 B2R4U2 E1P517
Symbols DJ122O8.2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMIT      1 - 70
QGNMQLKELEKTLALAKS                                                         71 - 88
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.