Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.39
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -4.500 0.000
posterior fossa group B ependymoma 1.800 0.000

Synonym

Accession Q9NU02 B3KUQ0 Q9H6Y9
Symbols ANKRD5

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDL      1 - 70
GAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGA     71 - 140
DVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAINSSTGRTALMEASREGVVEIVRGILERGGE    141 - 210
VNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWK    211 - 280
NLDHKTPRAVAKEGGFKAASKEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRG    281 - 350
DGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGM    351 - 420
GKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSE    421 - 490
KVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWT    491 - 560
PLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDV    561 - 630
AKAYADYRIIDLIKEKLDNLPKPAENQKLKGKTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGN    631 - 700
VVHLNSLITSGYTKKVDITFIPRRIWSPEATTAELIRKRELRRERFTHEVDFDDFMMPFQKNITEKARAL    701 - 770
EAALKT                                                                    771 - 776
//

Text Mined References (5)

PMID Year Title
17142250 2007 Sex-specific linkage to total serum immunoglobulin E in families of children with asthma in Costa Rica.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.