Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.037
osteosarcoma -1.192 0.000
ependymoma -1.300 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -2.000 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -1.100 0.010
adrenocortical carcinoma 1.014 0.005
adult high grade glioma -1.700 0.000
subependymal giant cell astrocytoma -1.230 0.047

Synonym

Accession Q9NTX9 B3KWH1 Q9NTA3
Symbols C20orf177
dJ551D2.5

Gene

 Compartment GO Term (0)

AA Sequence

MNAGPSWNKVQHSKNSSGKRQSKSQVPHASSQPRSSLTAVTQPTEEKLKESISPEARRKRNPLGSRCQGA      1 - 70
SGNKLFLDFQSMKIIKENADEDSASDLSDSERIPIPPSPLTPPDLNLRAEEIDPVYFDLHPGQGHTKPEY     71 - 140
YYPNFLPSPFSSWDLRDMALLLNAENKTEAVPRVGGLLGKYIDRLIQLEWLQVQTVQCEKAKGGKARPPT    141 - 210
APGTSGALKSPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFC    211 - 280
SQRQTLEMRTEEKKKKSSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHP    281 - 350
RKKGKAESCGHATVSSEKKLKTNGVKQNTYKLK                                         351 - 383
//

Text Mined References (8)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.