Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 4
Funding $281,588.5
PubMed Score 8.53
PubTator Score 14.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.700 0.000
lung cancer -1.100 0.001
adult high grade glioma -1.100 0.014
group 4 medulloblastoma 1.100 0.007
subependymal giant cell astrocytoma -2.523 0.017
lung adenocarcinoma -1.100 0.000
ovarian cancer -2.600 0.000

Gene RIF (10)

PMID Text
25327252 the maintenance of unliganded RNF146 in an inactive state may serve to maintain the stability of the RNF146-TNKS complex, which in turn regulates the homeostasis of PARylation-dependent ubiquitination activity in the cell
24454854 RNF146 regulated the development and progression of NSCLC
22274711 RNF146/Iduna has been found to be implicated in neurodegenerative disease and cancer development. [Review]
22267412 the RNF146 WWE domain recognizes poly(ADP-ribose) (PAR) by interacting with iso-ADP-ribose (iso-ADPR), the smallest internal PAR structural unit containing the characteristic ribose-ribose glycosidic bond formed during poly(ADP-ribosyl)ation.
21825151 Iduna is a Poly(ADP-ribose)-dependent ubiquitin E3 ligase.
21799911 RNF146 RING-type ubiquitin E3 ligase as a positive regulator of Wnt signaling that operates with tankyrase to maintain low steady-state levels of Axin proteins
19517271 Mutations in the coding regions of the RNF146 and ECHDC1 genes do not contribute to the burden of inherited predisposition of breast cancer in Ashkenazi high risk women.
19517271 Observational study of gene-disease association. (HuGE Navigator)
18326623 Genome-wide association study of gene-disease association. (HuGE Navigator)
15813938 Dactylidin may function early in the progression of Alzheimer's disease.

AA Sequence

MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKR      1 - 70
CALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLI     71 - 140
AGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGA    141 - 210
SVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPA    211 - 280
PDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRP    281 - 350
DGQCTVTEV                                                                 351 - 359
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25327252 2015 Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal.
24454854 2014 Overexpression of RNF146 in non-small cell lung cancer enhances proliferation and invasion of tumors through the Wnt/?-catenin signaling pathway.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22274711 Ring finger protein 146/Iduna is a poly(ADP-ribose) polymer binding and PARsylation dependent E3 ubiquitin ligase.
22267412 2012 Recognition of the iso-ADP-ribose moiety in poly(ADP-ribose) by WWE domains suggests a general mechanism for poly(ADP-ribosyl)ation-dependent ubiquitination.
21825151 2011 Iduna is a poly(ADP-ribose) (PAR)-dependent E3 ubiquitin ligase that regulates DNA damage.
21799911 2011 Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.
21602803 2011 Iduna protects the brain from glutamate excitotoxicity and stroke by interfering with poly(ADP-ribose) polymer-induced cell death.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
More...