Property Summary

NCBI Gene PubMed Count 13
Grant Count 7
R01 Count 4
Funding $316,019.4
PubMed Score 126.62
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.022 0.017
pancreatic ductal adenocarcinoma liver m... -1.785 0.003
breast carcinoma -1.400 0.000
lung adenocarcinoma -1.600 0.000
Breast cancer -1.900 0.000
progressive supranuclear palsy -1.100 0.015
ductal carcinoma in situ -1.200 0.000
invasive ductal carcinoma -2.100 0.000
ovarian cancer -2.100 0.000

Gene RIF (5)

PMID Text
20407466 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19789366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19517271 Mutations in the coding regions of the RNF146 and ECHDC1 genes do not contribute to the burden of inherited predisposition of breast cancer in Ashkenazi high risk women.
19517271 Observational study of gene-disease association. (HuGE Navigator)
18326623 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLN      1 - 70
NPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTL     71 - 140
TRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALK    141 - 210
VLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQ    211 - 280
NERDLLGTVWGGPANLEAIAKKGKFNK                                               281 - 307
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22016388 2011 Ethylmalonyl-CoA decarboxylase, a new enzyme involved in metabolite proofreading.
21269460 2011 Initial characterization of the human central proteome.
20407466 2010 Risk of breast and prostate cancer is not associated with increased homozygosity in outbred populations.
19789366 2009 Evaluation of 11 breast cancer susceptibility loci in African-American women.
19517271 2009 The RNF146 and ECHDC1 genes as candidates for inherited breast and ovarian cancer in Jewish Ashkenazi women.
18326623 2008 Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33.
More...