Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.47
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical adenoma -1.055 5.2e-03
adrenocortical carcinoma -1.774 3.5e-12
adult high grade glioma -1.400 2.5e-02
astrocytic glioma -1.600 1.2e-02
Astrocytoma, Pilocytic -1.100 1.7e-02
atypical teratoid / rhabdoid tumor -1.900 3.6e-06
ependymoma -2.100 3.0e-03
glioblastoma -1.300 1.9e-04
medulloblastoma -1.700 1.9e-02
medulloblastoma, large-cell -1.600 1.3e-02
oligodendroglioma -1.700 9.0e-03
ovarian cancer -1.700 1.4e-07
Pick disease -1.200 7.6e-03
psoriasis -1.500 4.5e-07

AA Sequence

MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSK      1 - 70
VAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLM     71 - 140
LNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL             141 - 201
//

Text Mined References (15)

PMID Year Title