Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $334,460.4
PubMed Score 3.68
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -3.300 0.000
posterior fossa group B ependymoma -2.900 0.000
oligodendroglioma -3.500 0.000
glioblastoma multiforme -3.200 0.000
medulloblastoma -2.300 0.017
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.400 0.002
adrenocortical adenoma -1.330 0.001
adrenocortical carcinoma -2.166 0.000
adult high grade glioma -1.400 0.025
pilocytic astrocytoma -2.000 0.012
Pick disease -1.200 0.008
ovarian cancer -1.700 0.000
psoriasis -1.500 0.000

AA Sequence

MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSK      1 - 70
VAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLM     71 - 140
LNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL             141 - 201
//

Text Mined References (15)

PMID Year Title
22220752 2012 The Cbln family of proteins interact with multiple signaling pathways.
22191730 2012 Glutamate receptor ?1 induces preferentially inhibitory presynaptic differentiation of cortical neurons by interacting with neurexins through cerebellin precursor protein subtypes.
21410790 2011 Cbln family proteins promote synapse formation by regulating distinct neurexin signaling pathways in various brain regions.
21356198 2011 Differential interactions of cerebellin precursor protein (Cbln) subtypes and neurexin variants for synapse formation of cortical neurons.
19212655 2009 Precerebellin-related genes and precerebellin 1 peptide in the adrenal gland of the rat: expression pattern, localization, developmental regulation and effects on corticosteroidogenesis.
18278437 2008 Cbln and C1q family proteins: new transneuronal cytokines.
17331201 2007 Characterization of a transneuronal cytokine family Cbln--regulation of secretion by heteromeric assembly.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...