Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.79
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.6e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 4.6e-03

Gene RIF (2)

AA Sequence

MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGR      1 - 70
GSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAE     71 - 140
QQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN              141 - 200
//

Text Mined References (9)

PMID Year Title