Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
Funding $293,224
PubMed Score 0.79
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.005

Gene RIF (2)

PMID Text
24504521 The frequency of the ESRRA/C11orf20 gene fusion in serous ovarian carcinomas of stages III and IV must be very low.
21949640 ESRRA-C11orf20, a gene fusion between ESRRA and C11orf20 (TEX40) is recurrent serous ovarian carcinoma.

AA Sequence

MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGR      1 - 70
GSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAE     71 - 140
QQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN              141 - 200
//

Text Mined References (8)

PMID Year Title
24504521 2014 Low frequency of ESRRA-C11orf20 fusion gene in ovarian carcinomas.
21949640 2011 ESRRA-C11orf20 is a recurrent gene fusion in serous ovarian carcinoma.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.