Property Summary

NCBI Gene PubMed Count 15
PubMed Score 47.46
PubTator Score 26.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 5.56787915951384E-7
osteosarcoma 7933 1.95461356145387E-5
pituitary cancer 1972 4.12273552011192E-5
acute quadriplegic myopathy 1157 9.28122892050737E-5
ductal carcinoma in situ 1745 0.00168661206375523
fibroadenoma 557 0.0293209412468893
acute myeloid leukemia 785 0.0390847932009602

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -2.003 0.000
acute quadriplegic myopathy -1.182 0.000
fibroadenoma -1.100 0.029
ductal carcinoma in situ -1.100 0.002
acute myeloid leukemia -1.300 0.039
pituitary cancer 1.100 0.000

Synonym

Accession Q9NTM9 Q5TCZ8 Q9Y321
Symbols CGI-32

Gene

PANTHER Protein Class (2)

PDB

3IWP  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
19878721 Results suggest that hCutC functions as an enzyme with Cu(I) as a cofactor rather than a copper transporter and the potential Cu(I)-binding site consists of the two Cys residues and other conserved residues in the vicinity.
16182249 Cloning, expression and subcellular localization of CutC.

AA Sequence

MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVV      1 - 70
KQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPL     71 - 140
PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQ    141 - 210
RILEGSGATEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV           211 - 273
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19878721 2010 Crystal structure of human copper homeostasis protein CutC reveals a potential copper-binding site.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...