Property Summary

NCBI Gene PubMed Count 29
Grant Count 7
R01 Count 5
Funding $1,623,483.25
PubMed Score 28.04
PubTator Score 18.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.441 0.014
Multiple myeloma 2.186 0.001
astrocytic glioma -1.800 0.008
ependymoma -2.200 0.013
oligodendroglioma -1.800 0.018
glioblastoma -2.400 0.000
medulloblastoma -1.500 0.001
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.700 0.002
colon cancer 1.500 0.001
lung cancer 2.400 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.658 0.048
Pick disease -1.100 0.003

 GO Process (1)

Gene RIF (13)

PMID Text
26360636 HIV-1 MA interacts with OLA1
26360636 HIV-1 MA interacts with OLA1
26283179 Our work suggests that OLA1 is a novel translational GTPase and plays a suppressive role in translation and cell survival, as well as cancer growth and progression.
24486488 OLA1 plays an important negative role in cell adhesion and spreading, in part through the regulation of FAK expression and cofilin phosphorylation, and manipulation of OLA1 may lead to significant changes in cell adhesion and the associated phenotypes.
24289923 OLA1 plays an important role in centrosome regulation together with BRCA1.
23412384 Downregulation of OLA1 in mammalian cells by either RNAi or targeted gene disruption results in reduced steady-state levels of HSP70, impaired HSP70 induction by heat, and functionally, increased cellular sensitivity to heat shock.
22190034 HIV-1 MA interacts with OLA1
22190034 HIV-1 MA interacts with OLA1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20053727 DOC45 is a novel ATPase that is linked to cellular stress response and tumorigenesis, and may also serve as a valuable tumor marker.
More...

AA Sequence

MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER      1 - 70
FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD     71 - 140
PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE    141 - 210
IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ    211 - 280
KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY    281 - 350
EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK                            351 - 396
//

Text Mined References (34)

PMID Year Title
27271530 2016 OLA1 gene sequencing in patients with BRCA1/2 mutation-negative suspected hereditary breast and ovarian cancer.
26863455 2016 OLA1 contributes to epithelial-mesenchymal transition in lung cancer by modulating the GSK3?/snail/E-cadherin signaling.
26655089 2016 Obg-like ATPase 1 regulates global protein serine/threonine phosphorylation in cancer cells by suppressing the GSK3?-inhibitor 2-PP1 positive feedback loop.
26283179 2015 OLA1 regulates protein synthesis and integrated stress response by inhibiting eIF2 ternary complex formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24486488 2014 Regulation of cell-matrix adhesion by OLA1, the Obg-like ATPase 1.
24411079 2014 OLA1 in centrosome biology alongside the BRCA1/BARD1 complex: looking beyond centrosomes.
24289923 2014 The BRCA1/BARD1-interacting protein OLA1 functions in centrosome regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...