Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.08
PubTator Score 18.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.800 8.6e-04
astrocytic glioma -1.800 7.9e-03
Astrocytoma, Pilocytic -1.600 5.9e-06
atypical teratoid / rhabdoid tumor -2.300 1.9e-05
colon cancer 1.400 4.4e-02
ependymoma -2.200 1.3e-02
glioblastoma -1.900 1.8e-07
lung cancer 2.400 1.4e-04
medulloblastoma -1.100 2.3e-03
medulloblastoma, large-cell -1.700 2.1e-03
Multiple myeloma 2.186 6.8e-04
oligodendroglioma -1.800 1.8e-02
Pick disease -1.100 3.4e-03
subependymal giant cell astrocytoma -1.658 4.8e-02
Waldenstrons macroglobulinemia 1.441 1.4e-02

Gene RIF (13)

AA Sequence

MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER      1 - 70
FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD     71 - 140
PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE    141 - 210
IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ    211 - 280
KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY    281 - 350
EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK                            351 - 396
//

Text Mined References (34)

PMID Year Title