Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.04
PubTator Score 18.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 2.82567137884801E-6
pilocytic astrocytoma 3086 4.7663098457287E-6
pediatric high grade glioma 2712 6.48078056987224E-6
atypical teratoid / rhabdoid tumor 4369 1.85663299782203E-5
lung cancer 4473 1.39737790386199E-4
medulloblastoma 1524 5.37454195084305E-4
colon cancer 1475 6.44448408804976E-4
Multiple myeloma 1328 6.83968381080073E-4
medulloblastoma, large-cell 6234 0.00209050628119719
Pick disease 1893 0.00339373753339109
astrocytic glioma 2241 0.00790623781206152
ependymoma 2514 0.012947794298248
Waldenstrons macroglobulinemia 765 0.0135655496640694
oligodendroglioma 2849 0.0175853779567626
subependymal giant cell astrocytoma 2287 0.0482618418462223

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.441 0.014
Multiple myeloma 2.186 0.001
astrocytic glioma -1.800 0.008
ependymoma -2.200 0.013
oligodendroglioma -1.800 0.018
glioblastoma -2.400 0.000
medulloblastoma -1.500 0.001
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.700 0.002
colon cancer 1.500 0.001
lung cancer 2.400 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.658 0.048
Pick disease -1.100 0.003

Synonym

Accession Q9NTK5 D7EHM2 Q5BJD7 Q8NCI8 Q96CU1 Q96SV2 Q9P1D3 Q9UNY9 Q9Y6G4
Symbols DOC45
GBP45
GTBP9
GTPBP9
PTD004

Gene

PANTHER Protein Class (2)

PDB

2OHF  

  Ortholog (17)

 GO Process (1)

Gene RIF (11)

PMID Text
26360636 HIV-1 MA interacts with OLA1
26283179 Our work suggests that OLA1 is a novel translational GTPase and plays a suppressive role in translation and cell survival, as well as cancer growth and progression.
24486488 OLA1 plays an important negative role in cell adhesion and spreading, in part through the regulation of FAK expression and cofilin phosphorylation, and manipulation of OLA1 may lead to significant changes in cell adhesion and the associated phenotypes.
24289923 OLA1 plays an important role in centrosome regulation together with BRCA1.
23412384 Downregulation of OLA1 in mammalian cells by either RNAi or targeted gene disruption results in reduced steady-state levels of HSP70, impaired HSP70 induction by heat, and functionally, increased cellular sensitivity to heat shock.
22190034 HIV-1 MA interacts with OLA1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20053727 DOC45 is a novel ATPase that is linked to cellular stress response and tumorigenesis, and may also serve as a valuable tumor marker.
19882753 knockdown of OLA1 inhibits breast cancer cell migration and invasion through a mechanism that involves the modulation of intracellular ROS levels
19706404 OLA1 suppresses the antioxidant response through nontranscriptional mechanisms.
More...

AA Sequence

MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER      1 - 70
FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD     71 - 140
PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE    141 - 210
IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ    211 - 280
KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY    281 - 350
EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK                            351 - 396
//

Text Mined References (34)

PMID Year Title
27271530 2016 OLA1 gene sequencing in patients with BRCA1/2 mutation-negative suspected hereditary breast and ovarian cancer.
26863455 2016 OLA1 contributes to epithelial-mesenchymal transition in lung cancer by modulating the GSK3?/snail/E-cadherin signaling.
26655089 2016 Obg-like ATPase 1 regulates global protein serine/threonine phosphorylation in cancer cells by suppressing the GSK3?-inhibitor 2-PP1 positive feedback loop.
26283179 2015 OLA1 regulates protein synthesis and integrated stress response by inhibiting eIF2 ternary complex formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24486488 2014 Regulation of cell-matrix adhesion by OLA1, the Obg-like ATPase 1.
24411079 2014 OLA1 in centrosome biology alongside the BRCA1/BARD1 complex: looking beyond centrosomes.
24289923 2014 The BRCA1/BARD1-interacting protein OLA1 functions in centrosome regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...