Property Summary

NCBI Gene PubMed Count 22
Grant Count 80
R01 Count 40
Funding $8,293,002.03
PubMed Score 376.25
PubTator Score 19.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NTK1 B2R6A1 O94997 Q5T735 Q76MX8
Symbols FIG
DEPP
Fseg

Gene

Gene RIF (9)

PMID Text
25261981 Knockdown of DEPP prevented the primary and secondary reactive oxygen species wave during FOXO3 activation.
24936657 C10orf10 expression is frequently decreased in breast cancer tissues and is associated with shorter survival times.
21510935 DEPP is regulated at the level of transcription by FoxO in human vascular endothelial cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20822508 Observational study of gene-disease association. (HuGE Navigator)
19937567 DEPP is a novel insulin-regulatory molecule expressed abundantly in insulin-sensitive tissues including white adipose tissue and liver.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16123073 Depp modulates the effects of progesterone during decidualization and in the decidua by affecting gene expression.
15977181 Expressed in endothelial cells of peripheral tissues, but not in atrial or ventricular endocardial cells of the heart, unexpected degree of molecular heterogeneity among arterial endothelial cells, up-regulated in subsets of endothelial cells.

AA Sequence

MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPA      1 - 70
QACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMD     71 - 140
SSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIH    141 - 210
EL                                                                        211 - 212
//

Text Mined References (22)

PMID Year Title
25261981 2014 C10ORF10/DEPP, a transcriptional target of FOXO3, regulates ROS-sensitivity in human neuroblastoma.
24936657 2014 Decreased expression of C10orf10 and its prognostic significance in human breast cancer.
24530860 2014 The c10orf10 gene product is a new link between oxidative stress and autophagy.
21510935 2011 FoxO regulates expression of decidual protein induced by progesterone (DEPP) in human endothelial cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20822508 2010 Association between CETP Taq1B and LIPC -514C/T polymorphisms with the serum lipid levels in a group of Tehran's population: a cross sectional study.
19937567 2010 Insulin-mediated regulation of decidual protein induced by progesterone (DEPP) in adipose tissue and liver.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
More...