Property Summary

NCBI Gene PubMed Count 23
PubMed Score 396.42
PubTator Score 19.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 2.053 3.1e-02
acute quadriplegic myopathy 1.560 1.7e-06
adrenocortical carcinoma -1.491 5.0e-03
atypical teratoid / rhabdoid tumor -1.800 1.7e-03
Breast cancer -2.200 2.4e-12
breast carcinoma -1.600 1.1e-03
ductal carcinoma in situ -2.000 4.2e-05
fibroadenoma -2.100 5.8e-03
gastric carcinoma 1.100 1.5e-02
glioblastoma 1.900 2.5e-02
intraductal papillary-mucinous adenoma (... -1.100 3.5e-03
intraductal papillary-mucinous carcinoma... -1.200 3.5e-03
intraductal papillary-mucinous neoplasm ... -2.100 7.3e-03
invasive ductal carcinoma -1.600 9.7e-04
lung adenocarcinoma -2.600 4.2e-15
lung cancer -1.200 1.5e-02
lung carcinoma -1.500 1.8e-06
malignant mesothelioma -2.100 9.6e-07
medulloblastoma -1.300 8.0e-03
medulloblastoma, large-cell -1.900 3.8e-02
non-small cell lung cancer -1.606 1.1e-11
ovarian cancer 1.500 5.9e-03
pituitary cancer -1.700 2.7e-03
posterior fossa group B ependymoma -2.000 1.0e-04
psoriasis -1.200 1.3e-03

Synonym

Accession Q9NTK1 B2R6A1 O94997 Q5T735 Q76MX8
Symbols FIG
DEPP
Fseg
C10orf10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPA      1 - 70
QACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMD     71 - 140
SSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIH    141 - 210
EL                                                                        211 - 212
//

Text Mined References (23)

PMID Year Title