Property Summary

NCBI Gene PubMed Count 20
Grant Count 11
Funding $1,187,805.9
PubMed Score 188.53
PubTator Score 76.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
Pick disease -1.200 0.000
ovarian cancer 1.200 0.000

Gene RIF (32)

PMID Text
23486476 Man2C1 has dual functions: one in glycan catabolism and another in apoptotic signaling.
21556061 MAN2C1 binds PTEN thereby inhibiting its phosphatidylinositol 3,4,5 triphosphate phosphatase activity
21508515 MAN2C1 methylation levels modify cumulative traumatic burden on risk of post traumatic stress disorder
20978011 regulation of Man2C1 expression is essential for maintaining efficient protein N-glycosylation
19572206 Reduced antibody response to BSA was observed in transgenic mice, suggesting that specific antibody response to tumor antigens might be suppressed by hMan2c1 transgene.
19018777 Inhibition of MAN2C1 gene expression suppresses growth of esophageal carcinoma cells through mitotic arrest and apoptosis.
18330979 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18314154 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18215327 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
16721356 Results suggest that inhibition of alpha-mannosidase Man2c1 gene expression enhances adhesion of Jurkat T cells.
More...

AA Sequence

MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAVQRDFRPAQVG      1 - 70
DSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPR     71 - 140
SLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAVFHRDVHMLLVDLELLLGIAKGLGKDNQRSF    141 - 210
QALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSW    211 - 280
VTALQLMERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQF    281 - 350
LQGQNFFLQEFGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRV    351 - 420
LVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLSNTDGLPRVQL    421 - 490
SSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGNRECERILHDVELLSSLALARSAQFLYP    491 - 560
AAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAMCHYEDIRSHGNTLLSAAAAALCAGEPGPEGLLIVNTL    561 - 630
PWKRIEVMALPKPGGAHSLALVTVPSMGYAPVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDP    631 - 700
TGRLTSLVLVASGREAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGS    701 - 770
AWFLLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYN    771 - 840
TSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTGRHEFTYALMP    841 - 910
HKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETVKQAESSPQRRSLVLRLYEAH    911 - 980
GSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDNRLKLTFSPFQVLSLLLVLQPPPH              981 - 1040
//

Text Mined References (22)

PMID Year Title
23486476 2013 Dual functions for cytosolic ?-mannosidase (Man2C1): its down-regulation causes mitochondria-dependent apoptosis independently of its ?-mannosidase activity.
21556061 2011 ?-Mannosidase 2C1 attenuates PTEN function in prostate cancer cells.
21508515 2011 Gene expression and methylation signatures of MAN2C1 are associated with PTSD.
21269460 2011 Initial characterization of the human central proteome.
20978011 2011 Overexpression of Man2C1 leads to protein underglycosylation and upregulation of endoplasmic reticulum-associated degradation pathway.
19572206 2010 hMan2c1 transgene promotes tumor progress in mice.
19018777 2008 Inhibition of alpha-mannosidase Man2c1 gene expression suppresses growth of esophageal carcinoma cells through mitotic arrest and apoptosis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16721356 2006 Inhibition of the alpha-mannosidase Man2c1 gene expression enhances adhesion of Jurkat cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...