Property Summary

NCBI Gene PubMed Count 26
PubMed Score 28.00
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 2.283 2.8e-05
adult high grade glioma 2.000 7.4e-06
astrocytoma 1.100 3.3e-07
Astrocytoma, Pilocytic 1.100 2.8e-06
Atopic dermatitis 1.200 4.9e-04
atypical teratoid / rhabdoid tumor 2.900 5.4e-11
Breast cancer 2.300 2.6e-02
breast carcinoma 1.300 9.1e-34
ductal carcinoma in situ 1.400 6.3e-04
ependymoma 1.800 6.3e-11
glioblastoma 2.400 1.5e-10
group 3 medulloblastoma 2.800 9.3e-07
intraductal papillary-mucinous carcinoma... 1.900 8.3e-04
intraductal papillary-mucinous neoplasm ... 2.500 1.4e-03
invasive ductal carcinoma 1.600 6.7e-04
lung adenocarcinoma 1.539 1.3e-05
lung cancer 1.400 1.5e-02
malignant mesothelioma 2.200 2.6e-08
medulloblastoma, large-cell 3.700 2.0e-07
nasopharyngeal carcinoma 1.300 2.2e-05
non-small cell lung cancer 1.893 5.6e-21
oligodendroglioma 1.200 2.3e-05
ovarian cancer 1.600 1.0e-03
primary Sjogren syndrome 1.400 4.4e-03
primitive neuroectodermal tumor 2.600 3.6e-05
progressive supranuclear palsy -1.200 7.3e-03
Waldenstrons macroglobulinemia 1.188 2.7e-02

Gene RIF (7)

AA Sequence

MPRKGTQPSTARRREEGPPPPSPDGASSDAEPEPPSGRTESPATAAETASEELDNRSLEEILNSIPPPPP      1 - 70
PAMTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSK     71 - 140
KLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPNSNFYVSRTACRDNTSVYHISGKKKTFKDVG    141 - 210
NLLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEH    211 - 280
RGEKLNRVKMVEKEKDALEGEKNIAIEFLTLENEIFRKKNHVCQYYIYELQKRIAEMETQKEKIHEDTKE    281 - 350
INEKSNILSNEMKAKNKDVKDTEKKLNKITKFIEENKEKFTQLDLEDVQVREKLKHATSKAKKLEKQLQK    351 - 420
DKEKVEEFKSIPAKSNNIINETTTRNNALEKEKEKEEKKLKEVMDSLKQETQGLQKEKESREKELMGFSK    421 - 490
SVNEARSKMDVAQSELDIYLSRHNTAVSQLTKAKEALIAASETLKERKAAIRDIEGKLPQTEQELKEKEK    491 - 560
ELQKLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYD    561 - 630
VAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVK    631 - 700
DEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSLVIE    701 - 770
ISEEEVNKMESQLQNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTLEKFTASIQRLIEQEEYLNVQVK    771 - 840
ELEANVLATAPDKKKQKLLEENVSAFKTEYDAVAEKAGKVEAEVKRLHNTIVEINNHKLKAQQDKLDKIN    841 - 910
KQLDECASAITKAQVAIKTADRNLQKAQDSVLRTEKEIKDTEKEVDDLTAELKSLEDKAAEVVKNTNAAE    911 - 980
ESLPEIQKEHRNLLQELKVIQENEHALQKDALSIKLKLEQIDGHIAEHNSKIKYWHKEISKISLHPIEDN    981 - 1050
PIEEISVLSPEDLEAIKNPDSITNQIALLEARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSF   1051 - 1120
RQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFN   1121 - 1190
LSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISD   1191 - 1260
RLIGIYKTYNITKSVAVNPKEIASKGLC                                             1261 - 1288
//

Text Mined References (40)

PMID Year Title