Property Summary

NCBI Gene PubMed Count 26
PubMed Score 23.25
PubTator Score 21.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 6.72099965945957E-32
non-small cell lung cancer 2798 5.59587812845845E-21
atypical teratoid / rhabdoid tumor 4369 5.39580698140321E-11
sonic hedgehog group medulloblastoma 1482 3.18543999361959E-9
astrocytoma 1493 8.54656822434613E-9
posterior fossa group A ependymoma 1511 1.50111416586768E-8
malignant mesothelioma 3163 2.55417298406488E-8
medulloblastoma, large-cell 6234 1.95847902934294E-7
pediatric high grade glioma 2712 3.02589135657646E-7
oligodendroglioma 2849 7.23308991693559E-7
pilocytic astrocytoma 3086 3.00959524155969E-6
primary Sjogren syndrome 789 8.62291972720543E-6
glioblastoma 5572 1.2314632025531E-5
lung adenocarcinoma 2714 1.27750720673349E-5
nasopharyngeal carcinoma 1056 2.18105947033695E-5
adrenocortical carcinoma 1427 2.82492421683581E-5
primitive neuroectodermal tumor 3031 3.58535994753627E-5
ovarian cancer 8492 1.33810909442453E-4
Atopic dermatitis 944 4.89871375355416E-4
ductal carcinoma in situ 1745 6.28218122733721E-4
invasive ductal carcinoma 2950 6.68545533466991E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.2876583646361E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00144492998127363
progressive supranuclear palsy 674 0.00731916225774307
lung cancer 4473 0.0152189811465983
Breast cancer 3099 0.0260299803310367
Waldenstrons macroglobulinemia 765 0.0269881716487505

Expression

Synonym

Accession Q9NTJ3 A6NLT9 D3DNL8 O95752 Q8NDL4 Q9UNT9 SMC protein 4
Symbols CAPC
CAP-C
SMC-4
SMC4L1

Gene

PDB

4U4P  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
26491021 analysis of functional differences of SMC2 and SMC4 hinge domain between condensins and cohesin in DNA recognition
25422241 Knockdown of SMC-4 expression significantly suppressed the proliferation.
25081869 Results indicate that miR-124-5p may target the tumorigenesis gene, SMC4, which suggests that expression levels of miR-124-5p in plasma and FFPE samples.
22842912 SMC4 expression was significantly associated with tumor size, de-differentiation, advanced stages and vascular invasion of the primary liver cancers.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19454010 Interaction of HIV-1 Tat with SMC4 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17488335 mutation analysis of hCAP-C & hCAP-E in leukemia-lymphoma cell lines including 8 pyothorax-associated lymphoma (PAL); 3 of 8 PAL cell lines have hCAP-C or hCAP-E heterozygous mutations, indicating condensin mutations are relatively frequent in PAL

AA Sequence

MPRKGTQPSTARRREEGPPPPSPDGASSDAEPEPPSGRTESPATAAETASEELDNRSLEEILNSIPPPPP      1 - 70
PAMTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSK     71 - 140
KLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPNSNFYVSRTACRDNTSVYHISGKKKTFKDVG    141 - 210
NLLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEH    211 - 280
RGEKLNRVKMVEKEKDALEGEKNIAIEFLTLENEIFRKKNHVCQYYIYELQKRIAEMETQKEKIHEDTKE    281 - 350
INEKSNILSNEMKAKNKDVKDTEKKLNKITKFIEENKEKFTQLDLEDVQVREKLKHATSKAKKLEKQLQK    351 - 420
DKEKVEEFKSIPAKSNNIINETTTRNNALEKEKEKEEKKLKEVMDSLKQETQGLQKEKESREKELMGFSK    421 - 490
SVNEARSKMDVAQSELDIYLSRHNTAVSQLTKAKEALIAASETLKERKAAIRDIEGKLPQTEQELKEKEK    491 - 560
ELQKLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYD    561 - 630
VAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVK    631 - 700
DEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSLVIE    701 - 770
ISEEEVNKMESQLQNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTLEKFTASIQRLIEQEEYLNVQVK    771 - 840
ELEANVLATAPDKKKQKLLEENVSAFKTEYDAVAEKAGKVEAEVKRLHNTIVEINNHKLKAQQDKLDKIN    841 - 910
KQLDECASAITKAQVAIKTADRNLQKAQDSVLRTEKEIKDTEKEVDDLTAELKSLEDKAAEVVKNTNAAE    911 - 980
ESLPEIQKEHRNLLQELKVIQENEHALQKDALSIKLKLEQIDGHIAEHNSKIKYWHKEISKISLHPIEDN    981 - 1050
PIEEISVLSPEDLEAIKNPDSITNQIALLEARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSF   1051 - 1120
RQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFN   1121 - 1190
LSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISD   1191 - 1260
RLIGIYKTYNITKSVAVNPKEIASKGLC                                             1261 - 1288
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491021 2015 Structural Basis for Dimer Formation of Human Condensin Structural Maintenance of Chromosome Proteins and Its Implications for Single-stranded DNA Recognition.
25422241 2014 Structural maintenance of chromosomes 4 is a predictor of survival and a novel therapeutic target in colorectal cancer.
25081869 2014 Low expression levels of microRNA-124-5p correlated with poor prognosis in colorectal cancer via targeting of SMC4.
24980149 2014 A novel miR-219-SMC4-JAK2/Stat3 regulatory pathway in human hepatocellular carcinoma.
23884423 2013 Ribosomal RNA gene transcription mediated by the master genome regulator protein CCCTC-binding factor (CTCF) is negatively regulated by the condensin complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22842912 2012 Overexpression of the structural maintenance of chromosome 4 protein is associated with tumor de-differentiation, advanced stage and vascular invasion of primary liver cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...