Property Summary

NCBI Gene PubMed Count 35
PubMed Score 363.00
PubTator Score 64.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.700 5.5e-04
astrocytic glioma -1.700 1.3e-02
Astrocytoma, Pilocytic -1.300 1.2e-04
atypical teratoid / rhabdoid tumor -1.900 1.6e-05
Breast cancer -1.100 1.3e-09
ependymoma -1.500 2.1e-02
glioblastoma -1.500 2.2e-06
group 4 medulloblastoma 1.400 4.7e-04
intraductal papillary-mucinous carcinoma... 1.300 1.1e-02
invasive ductal carcinoma -1.100 8.4e-04
lung adenocarcinoma -1.200 8.7e-20
malignant mesothelioma 2.400 1.3e-08
medulloblastoma, large-cell -2.200 3.2e-05
oligodendroglioma -1.100 2.3e-02
osteosarcoma -1.661 3.7e-03
ovarian cancer -1.200 1.4e-06
pituitary cancer 1.300 6.3e-04
primitive neuroectodermal tumor 1.500 2.2e-03
psoriasis -1.500 3.5e-03
subependymal giant cell astrocytoma -1.955 4.4e-02

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MAHSKTRTNDGKITYPPGVKEISDKISKEEMVRRLKMVVKTFMDMDQDSEEEKELYLNLALHLASDFFLK      1 - 70
HPDKDVRLLVACCLADIFRIYAPEAPYTSPDKLKDIFMFITRQLKGLEDTKSPQFNRYFYLLENIAWVKS     71 - 140
YNICFELEDSNEIFTQLYRTLFSVINNGHNQKVHMHMVDLMSSIICEGDTVSQELLDTVLVNLVPAHKNL    141 - 210
NKQAYDLAKALLKRTAQAIEPYITNFFNQVLMLGKTSISDLSEHVFDLILELYNIDSHLLLSVLPQLEFK    211 - 280
LKSNDNEERLQVVKLLAKMFGAKDSELASQNKPLWQCYLGRFNDIHVPIRLECVKFASHCLMNHPDLAKD    281 - 350
LTEYLKVRSHDPEEAIRHDVIVSIVTAAKKDILLVNDHLLNFVRERTLDKRWRVRKEAMMGLAQIYKKYA    351 - 420
LQSAAGKDAAKQIAWIKDKLLHIYYQNSIDDRLLVERIFAQYMVPHNLETTERMKCLYYLYATLDLNAVK    421 - 490
ALNEMWKCQNLLRHQVKDLLDLIKQPKTDASVKAIFSKVMVITRNLPDPGKAQDFMKKFTQVLEDDEKIR    491 - 560
KQLEVLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEMIKFLLERIAPVHIDTESISALIKQVNKSID    561 - 630
GTADDEDEGVPTDQAIRAGLELLKVLSFTHPISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIE    631 - 700
EDFPHIRSALLPVLHHKSKKGPPRQAKYAIHCIHAIFSSKETQFAQIFEPLHKSLDPSNLEHLITPLVTI    701 - 770
GHIALLAPDQFAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEEVSPETMVKIQAIKMMVRWLLGMK    771 - 840
NNHSKSGTSTLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIITLEQYQLCALA    841 - 910
INDECYQVRQVFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQCLVKNINVRREYLKQHAAVS    911 - 980
EKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDVKECLWFVLEILMAKNENNSHAFIRKMVENIKQT    981 - 1050
KDAQGPDDAKMNEKLYTVCDVAMNIIMSKSTTYSLESPKDPVLPARFFTQPDKNFSNTKNYLPPEMKSFF   1051 - 1120
TPGKPKTTNVLGAVNKPLSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMS   1121 - 1190
SPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESD   1191 - 1260
EQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEE   1261 - 1330
ERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAA   1331 - 1400
TKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRERR                          1401 - 1447
//

Text Mined References (54)

PMID Year Title