Property Summary

NCBI Gene PubMed Count 32
PubMed Score 338.40
PubTator Score 64.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 8.6568066079284E-20
ovarian cancer 8492 1.07423242966222E-10
Breast cancer 3099 1.32280245753905E-9
malignant mesothelioma 3163 1.26082021950898E-8
glioblastoma 5572 7.29024860917686E-7
pediatric high grade glioma 2712 1.39056507762419E-5
atypical teratoid / rhabdoid tumor 4369 1.57796296753196E-5
medulloblastoma, large-cell 6234 3.24273907688655E-5
pilocytic astrocytoma 3086 9.67890759380452E-5
group 4 medulloblastoma 1875 1.29880402436324E-4
pituitary cancer 1972 6.26226662631005E-4
invasive ductal carcinoma 2950 8.44941215848533E-4
primitive neuroectodermal tumor 3031 0.00224559046823713
psoriasis 6685 0.00354566155769687
osteosarcoma 7933 0.00367662607172668
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.011304497495985
astrocytic glioma 2241 0.013351726249951
ependymoma 2514 0.021042236220993
oligodendroglioma 2849 0.0234572216110307
subependymal giant cell astrocytoma 2287 0.0436651188685837
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Type 2 diabetes mellitus 192 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
astrocytic glioma -1.700 0.013
ependymoma -1.500 0.021
oligodendroglioma -1.100 0.023
psoriasis -1.500 0.004
glioblastoma -2.300 0.000
osteosarcoma -1.661 0.004
group 4 medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor 1.500 0.002
intraductal papillary-mucinous carcinoma... 1.300 0.011
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -1.955 0.044
lung adenocarcinoma -1.200 0.000
Breast cancer -1.100 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -1.400 0.000
pituitary cancer 1.300 0.001

Synonym

Accession Q9NTI5 Q5R3S3 Q5W0K8 Q6NSC3 Q8IXT6 Q9H5N8 Q9Y2I5 Q9Y451
Symbols AS3
APRIN
CG008

Gene

PDB

5HDT  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (9)

PMID Text
23850494 Frameshift mutations of SGOL1 and PDS5B and the loss of their expression may be a feature of gastric and colorectal cancers with high microsatellite instability.
22293751 Here, the authors use proteomic profiling to identify APRIN (PDS5B), a cohesion-associated protein, as a BRCA2-associated protein.
20383194 Loss of a cohesin-linked suppressor APRIN (Pds5b) disrupts stem cell programs in embryonal carcinoma.
19737411 Pard-3 and AS3 genes are mutationally inactivated in prostate cancer cells.
19460752 Knockdown of PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae, PDS5B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19454010 Interaction of HIV-1 Tat with PDS5B in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
19412548 identified a functional missense mutation (R1292Q) in the PDS5B DNA-binding domain in a family with Cornelia de Lange syndrome, in which affected individuals also develop megacolon
18499069 The results of this study indicate that the aberrant expression of AS3 may be involved in the tumorigenesis of esophagus and is responsible for the male predominance of ESCC.
12072405 AS3 is a mediator of the proliferative arrest in the normal rat prostate in situ and that its expression is androgen-induced (AS3 protein)

AA Sequence

MAHSKTRTNDGKITYPPGVKEISDKISKEEMVRRLKMVVKTFMDMDQDSEEEKELYLNLALHLASDFFLK      1 - 70
HPDKDVRLLVACCLADIFRIYAPEAPYTSPDKLKDIFMFITRQLKGLEDTKSPQFNRYFYLLENIAWVKS     71 - 140
YNICFELEDSNEIFTQLYRTLFSVINNGHNQKVHMHMVDLMSSIICEGDTVSQELLDTVLVNLVPAHKNL    141 - 210
NKQAYDLAKALLKRTAQAIEPYITNFFNQVLMLGKTSISDLSEHVFDLILELYNIDSHLLLSVLPQLEFK    211 - 280
LKSNDNEERLQVVKLLAKMFGAKDSELASQNKPLWQCYLGRFNDIHVPIRLECVKFASHCLMNHPDLAKD    281 - 350
LTEYLKVRSHDPEEAIRHDVIVSIVTAAKKDILLVNDHLLNFVRERTLDKRWRVRKEAMMGLAQIYKKYA    351 - 420
LQSAAGKDAAKQIAWIKDKLLHIYYQNSIDDRLLVERIFAQYMVPHNLETTERMKCLYYLYATLDLNAVK    421 - 490
ALNEMWKCQNLLRHQVKDLLDLIKQPKTDASVKAIFSKVMVITRNLPDPGKAQDFMKKFTQVLEDDEKIR    491 - 560
KQLEVLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEMIKFLLERIAPVHIDTESISALIKQVNKSID    561 - 630
GTADDEDEGVPTDQAIRAGLELLKVLSFTHPISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIE    631 - 700
EDFPHIRSALLPVLHHKSKKGPPRQAKYAIHCIHAIFSSKETQFAQIFEPLHKSLDPSNLEHLITPLVTI    701 - 770
GHIALLAPDQFAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEEVSPETMVKIQAIKMMVRWLLGMK    771 - 840
NNHSKSGTSTLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIITLEQYQLCALA    841 - 910
INDECYQVRQVFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQCLVKNINVRREYLKQHAAVS    911 - 980
EKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDVKECLWFVLEILMAKNENNSHAFIRKMVENIKQT    981 - 1050
KDAQGPDDAKMNEKLYTVCDVAMNIIMSKSTTYSLESPKDPVLPARFFTQPDKNFSNTKNYLPPEMKSFF   1051 - 1120
TPGKPKTTNVLGAVNKPLSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMS   1121 - 1190
SPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESD   1191 - 1260
EQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEE   1261 - 1330
ERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAA   1331 - 1400
TKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRERR                          1401 - 1447
//

Text Mined References (51)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141881 2013 Pds5B is required for cohesion establishment and Aurora B accumulation at centromeres.
23850494 2013 Frameshift mutations of chromosome cohesion-related genes SGOL1 and PDS5B in gastric and colorectal cancers with high microsatellite instability.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22293751 2012 APRIN is a cell cycle specific BRCA2-interacting protein required for genome integrity and a predictor of outcome after chemotherapy in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
More...