Property Summary

Ligand Count 42
NCBI Gene PubMed Count 174
PubMed Score 583.27
PubTator Score 219.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.200 3.7e-04
osteosarcoma -1.732 9.8e-06
psoriasis -1.100 3.0e-03

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (159)

AA Sequence

MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEPLDPARPLQRP      1 - 70
PRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRV     71 - 140
VVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTH    141 - 210
YFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRC    211 - 280
PVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGP    281 - 350
LAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK                         351 - 399
//

Text Mined References (183)

PMID Year Title