Property Summary

NCBI Gene PubMed Count 139
Grant Count 148
R01 Count 82
Funding $22,492,061.3
PubMed Score 469.74
PubTator Score 219.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.003
osteosarcoma -1.732 0.000
inflammatory breast cancer -1.200 0.000

Synonym

Accession Q9NTG7 B7Z5U6 Q9Y6E8 hSIRT3
Symbols SIR2L3

Gene

PDB

3GLR   3GLT   3GLU   4BVE   4BVF   4BVG   4C78   5BWO   3GLS   4BN4   4BN5   4BV3   4BVB   4BVH   4C7B   4FVT   4FZ3   4HD8   4JSR   4JT8   4JT9   4O8Z   4V1C   5BWN   5D7N  

Gene RIF (124)

PMID Text
27078640 Data suggest that DNA sequence variants (DSVs) identified in myocardial infarction (MI) patients may change sirtuin 3 (SIRT3) level by affecting the transcriptional activity of SIRT3 gene promoter, contributing to the MI development as a risk factor.
26950437 physiological significance of SIRT3 on HBx-induced oxidative stress
26743598 SIRT3 has a pro-proliferative function in melanoma
26722027 Development of novel SIRT3 inhibitors, such as LC-0296, might enable the development of new targeted therapies to treat and improve the survival rate of patients with head and neck cancer.
26667041 Studies indicate that Many of the metabolic disorders have been associated with a reduction of sirtuins SIRT1 and SIRT3 at critical developmental windows throughout development.
26631723 Data suggest SIRT3-mediated inhibition of cell proliferation in B-cell malignancies is dependent on down-regulation of IDH2 and SOD2 activities via deacetylation; loss of SIRT3 stimulates cell proliferation via generation of reactive oxygen species.
26625292 microseed matrix seeding (MMS) was used to obtain crystals of human Sirt3 in its apo form and of human Sirt2 in complex with ADP ribose (ADPR).
26577410 These results reveal a novel post-translational regulation of MPC1 by Sirt3, which is important for its activity and colon cancer cell growth.
26520405 Benzyl butyl phthalate selectively disrupts sirtuins 1/3 in HepG2 cells to alter epigenetic processes and mitochondrial biogenesis.
26456643 siRNA-mediated silencing of sirtuin 3 expression decreased complex I activity in NNMT-expressing SH-SY5Y cells to that observed in wild-type SH-SY5Y, and significantly reduced cellular ATP content also
More...

AA Sequence

MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEPLDPARPLQRP      1 - 70
PRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRV     71 - 140
VVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTH    141 - 210
YFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRC    211 - 280
PVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGP    281 - 350
LAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK                         351 - 399
//

Text Mined References (147)

PMID Year Title
27078640 2016 Genetic and Functional Sequence Variants of the SIRT3 Gene Promoter in Myocardial Infarction.
26950437 2016 Protective Role of Sirtuin3 (SIRT3) in Oxidative Stress Mediated by Hepatitis B Virus X Protein Expression.
26743598 2016 Pro-Proliferative Function of Mitochondrial Sirtuin Deacetylase SIRT3 in Human Melanoma.
26722027 2016 A Novel Sirtuin-3 Inhibitor, LC-0296, Inhibits Cell Survival and Proliferation, and Promotes Apoptosis of Head and Neck Cancer Cells.
26667041 2016 Sirtuins-mediators of maternal obesity-induced complications in offspring?
26631723 2016 Loss of SIRT3 Provides Growth Advantage for B Cell Malignancies.
26625292 2015 Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
26577410 2015 Sirt3 binds to and deacetylates mitochondrial pyruvate carrier 1 to enhance its activity.
26520405 2015 The plasticizer BBP selectively inhibits epigenetic regulator sirtuins.
26456643 2015 Nicotinamide N-methyltransferase increases complex I activity in SH-SY5Y cells via sirtuin 3.
More...