Property Summary

NCBI Gene PubMed Count 24
PubMed Score 62.99
PubTator Score 38.52

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 6.52497865581817E-8
malignant mesothelioma 3163 5.11447065826504E-7
osteosarcoma 7933 3.56772813345593E-6
ovarian cancer 8492 2.3249535052249E-4
psoriasis 6685 2.80334578291544E-4
acute quadriplegic myopathy 1157 3.49133945200259E-4


  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
psoriasis 1.100 0.000
osteosarcoma -1.840 0.000
juvenile dermatomyositis 1.072 0.000
acute quadriplegic myopathy 1.018 0.000
ovarian cancer 2.100 0.000


Accession Q9NT62 Q6PKC5 Q9H6L9
Symbols APG3


PANTHER Protein Class (1)



  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (11)

26061804 ATG3 upregulation contributes to autophagy induced by the detachment of intestinal epithelial cells from the extracellular matrix, but promotes autophagy-independent apoptosis of the attached cells
26043688 The region of human ATG3 that interacts with ATG7 is precisely identified using nuclear magnetic resonance.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24420857 ATG3 gene and its gene family may play an important role in transformation of myelodysplastic syndrome.
24191030 13 residues of the ATG3 fragment form a short beta-strand followed by an alpha-helix on a surface area that is an exclusive binding site for ATG12.
24186333 Hidden Markov models were used to detect protein homology among the flexible regions of Atg3 homologs and importance of conserved regions evaluated by performing affinity capture experiments with human Atg3 deletion constructs; binding studies and competition experiments demonstrate that overlapping sites in the Atg3FR are important for E3 binding and E1 binding.
22644571 caspase-8 overexpression led to Atg3 degradation and this event depended on caspase-8 enzymatic activity
20723759 These results unveil a role for ATG12-ATG3 in mitochondrial homeostasis and implicate the ATG12 conjugation system in cellular functions distinct from the early steps of autophagosome formation.
20697744 Observational study of gene-disease association. (HuGE Navigator)
16704426 Murine Atg8L/Apg8L modification is mediated by human Atg3.

AA Sequence

GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM                                        281 - 314

Text Mined References (32)

PMID Year Title
26061804 2015 Upregulation of ATG3 contributes to autophagy induced by the detachment of intestinal epithelial cells from the extracellular matrix, but promotes autophagy-independent apoptosis of the attached cells.
26043688 2015 Identification and characterization of the linear region of ATG3 that interacts with ATG7 in higher eukaryotes.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24420857 2014 Lentiviral vector-mediate ATG3 overexpression inhibits growth and promotes apoptosis of human SKM-1 cells.
24191030 2013 Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
24186333 2013 Binding to E1 and E3 is mutually exclusive for the human autophagy E2 Atg3.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23119048 2012 Combination erlotinib-cisplatin and Atg3-mediated autophagy in erlotinib resistant lung cancer.
22644571 2012 Cleavage of Atg3 protein by caspase-8 regulates autophagy during receptor-activated cell death.