Property Summary

NCBI Gene PubMed Count 27
PubMed Score 74.57
PubTator Score 38.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 6.5e-08
malignant mesothelioma 3232 5.1e-07
osteosarcoma 7950 3.6e-06
ovarian cancer 8520 6.2e-06
psoriasis 6694 2.8e-04
acute quadriplegic myopathy 1158 3.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Granulomatous amebic encephalitis 8 3.135 1.6
Cancer 2499 3.112 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.018 3.5e-04
juvenile dermatomyositis 1.072 6.5e-08
malignant mesothelioma 1.900 5.1e-07
osteosarcoma -1.840 3.6e-06
ovarian cancer -1.200 6.2e-06
psoriasis 1.100 2.8e-04

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (13)

AA Sequence

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG      1 - 70
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS     71 - 140
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY    141 - 210
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG    211 - 280
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM                                        281 - 314
//

Text Mined References (35)

PMID Year Title