Property Summary

NCBI Gene PubMed Count 14
PubMed Score 120.46
PubTator Score 13.85

Knowledge Summary

Patent (2,718)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 1.45376094744635E-8
posterior fossa group A ependymoma 1511 7.15036049779755E-7
malignant mesothelioma 3163 3.07543441120902E-6
pediatric high grade glioma 2712 7.84805698631613E-6
glioblastoma 5572 9.88855656036413E-6
ovarian cancer 8492 3.61343731137647E-5
osteosarcoma 7933 8.44866341201223E-5
psoriasis 6685 1.62788451526937E-4
astrocytic glioma 2241 0.00255287474370425
primary Sjogren syndrome 789 0.00322417360363279
atypical teratoid / rhabdoid tumor 4369 0.00393162347561868
interstitial cystitis 2299 0.00843555282967522
subependymal giant cell astrocytoma 2287 0.0160779789834724
acute myeloid leukemia 785 0.0287847303532747
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0377580439477328
oligodendroglioma 2849 0.045921265945984
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (16)

Synonym

Accession Q9NSY1 O94791 Q4W5H2 Q8IYF2 Q8N2G7 Q8NHG9 Q9NTG8 BIKe
Symbols BIKE
HRIHFB2017

Gene

PDB

4W9W   4W9X   5I3O   5I3R   5IKW  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 IMPC Term (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
19927351 BMP2K gene 1379 G/A variant is strongly correlated with high myopia and may contribute to a genetic risk factor for high degrees of myopic pathogenesis.
19927351 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of BMP2 inducible kinase (BMP2K) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16753015 The association of the BMP-2 gene polymorphisms Ser37Ala and Arg190Ser with osteoporosis in 6353 men and women from the Rotterdam Study was studied.
15254968 PGE2 produced by COX-2 increased BMP-2 expression via binding the EP4 receptor.

AA Sequence

MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRT      1 - 70
HGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVN     71 - 140
QMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQ    141 - 210
KDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTI    211 - 280
PDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARK    281 - 350
SQIKARITDTIGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE    351 - 420
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQQQQQQQHHHH    421 - 490
HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQA    491 - 560
SPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGED    561 - 630
NFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSIN    631 - 700
QENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQG    701 - 770
DFNDDDTEPENLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA    771 - 840
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTKAPFSKKVNVQ    841 - 910
ECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFDEITGSQQQKVKQRSLQKLSS    911 - 980
RQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARRHKKVGRRDSQSSNEFLTISDSKENISVALT    981 - 1050
DGKDRGNVLQPEESLLDPFGAKPFHSPDLSWHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKM   1051 - 1120
DDFGAVPFTELVVQSITPHQSQQSQPVELDPFGAAPFPSKQ                                1121 - 1161
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19927351 2009 A novel genetic variant of BMP2K contributes to high myopia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...