Property Summary

Ligand Count 9
NCBI Gene PubMed Count 15
PubMed Score 140.79
PubTator Score 13.85

Knowledge Summary

Patent (2,718)


  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.800 2.9e-02
adult high grade glioma 1.200 1.1e-02
astrocytic glioma 1.700 2.6e-03
atypical teratoid / rhabdoid tumor 1.200 3.9e-03
Breast cancer -1.200 8.0e-08
ependymoma 1.300 1.3e-02
glioblastoma 1.200 4.6e-04
interstitial cystitis 1.400 8.4e-03
intraductal papillary-mucinous carcinoma... 1.100 3.8e-02
malignant mesothelioma -1.600 3.1e-06
oligodendroglioma 1.100 4.6e-02
osteosarcoma -1.966 1.4e-03
ovarian cancer 1.700 2.7e-05
primary Sjogren syndrome 1.100 3.2e-03
psoriasis -1.200 1.6e-04
subependymal giant cell astrocytoma 1.917 7.7e-03

Gene RIF (7)

AA Sequence

DDFGAVPFTELVVQSITPHQSQQSQPVELDPFGAAPFPSKQ                                1121 - 1161

Text Mined References (26)

PMID Year Title