Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.84
PubTator Score 0.92

Knowledge Summary

Patent (696)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Childhood medulloblastoma 4 4.106 2.1
Coloboma 51 3.295 1.6

Expression

Gene RIF (1)

AA Sequence

MAAPEPAPRRAREREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGLQSTFLAMDTEEGVEVVWN      1 - 70
ELHFGDRKAFAAHEEKIQTVFEQLVLVDHPNIVKLHKYWLDTSEACARVIFITEYVSSGSLKQFLKKTKK     71 - 140
NHKAMNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDTIFIQHNGLIKIGSVWHRIFSNALPDDLRSP    141 - 210
IRAEREELRNLHFFPPEYGEVADGTAVDIFSFGMCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMR    211 - 280
EFILCCLARDPARRPSAHSLLFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPR    281 - 350
PRRPPLQWRYSEVSFMELDKFLEDVRNGIYPLMNFAATRPLGLPRVLAPPPEEVQKAKTPTPEPFDSETR    351 - 420
KVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELVHYGFLHEDDRMKLAAFLE    421 - 490
STFLKYRGTQA                                                               491 - 501
//

Text Mined References (9)

PMID Year Title