Property Summary

NCBI Gene PubMed Count 27
Grant Count 74
R01 Count 55
Funding $6,070,579.92
PubMed Score 56.59
PubTator Score 24.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NSV4 A2A3B8 A2A3B9 A2A3C0 Q18P99 Q18PA0 Q18PA1 Q2KPB6 Q3ZK23 Q5JTP8 Q5T2S7 Q5XKF6 Q6MZF0 Q6NUP0 Q86VS4 Q8NAV4
Symbols AN
DIA2
DRF3
AUNA1
NSDAN
diap3
mDia2

Gene

 GWAS Trait (1)

Gene RIF (15)

PMID Text
26446836 we use a simple cellular system to examine fundamental features of formin-mediated filopodial assembly, using constitutively active constructs of the formins mDia2 and FMNL3
26179371 results suggest that inhibition of MT stability arising from DIAPH3 downregulation enhances susceptibility to MT poisons, and that the DIAPH3 network potentially reports taxane sensitivity in human tumors
24587343 An mDia2/ROCK signaling axis regulates invasive egress from epithelial ovarian cancer spheroids.
24403606 Dia1, Dia2, and Dia3 are involved in ErbB2-dependent capture of microtubules at the cell leading edge and ErbB2-driven guided migration.
23580645 TGF-beta promotes association of mDia2 with actin stress fibers, which further drives stress fiber formation and myofibroblast differentiation
22593025 In human tumours, DIAPH3 down-regulation was associated with aggressive or metastatic disease.
22184005 isoform-selective actin assembly by DIAPH3 exerts specific and differentially regulated functions during cell adhesion and motility.
21397845 These findings reveal a key role for mDia3 and its regulation by Aurora B phosphorylation in achieving proper stable kinetochore microtubule attachment.
21119010 the amino terminus of mDia2 serves as a coincidence detection module, directing mDia2 to the plasma membrane through interactions with phospholipids and activated Rif
19457867 mDia2 is degraded at the end of mitosis; mDia2 is targeted for disposal by post-translational ubiquitin modification; forced expression of activated mDia2 yields binucleate cells due to failed cytokinesis
More...

AA Sequence

MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDD      1 - 70
MLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKK     71 - 140
APLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSW    141 - 210
VESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPR    211 - 280
HPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVT    281 - 350
SPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV    351 - 420
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLT    421 - 490
QFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNI    491 - 560
PLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPIL    561 - 630
PFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIE    631 - 700
EKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSL    701 - 770
SQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL    771 - 840
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKA    841 - 910
SKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQS    911 - 980
IIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLL    981 - 1050
EMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSH   1051 - 1120
YNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARL   1121 - 1190
RAL                                                                      1191 - 1193
//

Text Mined References (31)

PMID Year Title
26446836 2015 Cell type-dependent mechanisms for formin-mediated assembly of filopodia.
26179371 2015 Regulation of microtubule dynamics by DIAPH3 influences amoeboid tumor cell mechanics and sensitivity to taxanes.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24587343 2014 An mDia2/ROCK signaling axis regulates invasive egress from epithelial ovarian cancer spheroids.
24403606 2014 Essential and nonredundant roles for Diaphanous formins in cortical microtubule capture and directed cell migration.
23580645 2013 Control of myofibroblast differentiation by microtubule dynamics through a regulated localization of mDia2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593025 2012 DIAPH3 governs the cellular transition to the amoeboid tumour phenotype.
22184005 2012 Differing and isoform-specific roles for the formin DIAPH3 in plasma membrane blebbing and filopodia formation.
21397845 2011 Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.
More...