Property Summary

NCBI Gene PubMed Count 28
PubMed Score 59.74
PubTator Score 24.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer 1.300 2.9e-07
adrenocortical carcinoma 1.739 2.6e-04
atypical teratoid / rhabdoid tumor 1.200 3.6e-06
Endometriosis 1.266 1.2e-02
ependymoma 1.200 2.3e-05
group 3 medulloblastoma 1.200 5.3e-03
intraductal papillary-mucinous carcinoma... 1.400 6.8e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-03
lung cancer 1.600 3.0e-03
malignant mesothelioma 1.200 1.5e-03
medulloblastoma, large-cell 1.700 1.4e-06
nasopharyngeal carcinoma 1.100 2.3e-03
osteosarcoma -1.475 7.1e-03
psoriasis 1.600 5.3e-92

Gene RIF (16)

AA Sequence

MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDD      1 - 70
MLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKK     71 - 140
APLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSW    141 - 210
VESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPR    211 - 280
HPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVT    281 - 350
SPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV    351 - 420
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLT    421 - 490
QFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNI    491 - 560
PLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPIL    561 - 630
PFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIE    631 - 700
EKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSL    701 - 770
SQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL    771 - 840
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKA    841 - 910
SKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQS    911 - 980
IIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLL    981 - 1050
EMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSH   1051 - 1120
YNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARL   1121 - 1190
RAL                                                                      1191 - 1193
//

Text Mined References (32)

PMID Year Title