Property Summary

NCBI Gene PubMed Count 230
PubMed Score 374.25
PubTator Score 359.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.100 1.1e-03
Breast cancer 1.300 4.2e-03
group 3 medulloblastoma 1.600 1.1e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-03
malignant mesothelioma 2.200 3.0e-06
osteosarcoma 1.181 1.6e-03
ovarian cancer -1.700 1.1e-05
psoriasis -1.100 2.4e-17

Protein-protein Interaction (2)

Gene RIF (238)

AA Sequence

MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLS      1 - 70
DLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVD     71 - 140
ALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKL    141 - 210
SLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWAN    211 - 280
MSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRI    281 - 350
MSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT    351 - 420
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL             421 - 481
//

Text Mined References (231)

PMID Year Title