Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.29

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NSQ0 B3KQ98
Symbols RRP7B
dJ222E13.2

Gene

AA Sequence

MEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSQKELLNYAWQHR      1 - 70
ESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY                                          71 - 103
//

Text Mined References (4)

PMID Year Title
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.