Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.29

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NSQ0 B3KQ98
Symbols RRP7B
dJ222E13.2

Gene

AA Sequence

MEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSQKELLNYAWQHR      1 - 70
ESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY                                          71 - 103
//

Text Mined References (4)

PMID Year Title