Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.78
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NSP4 A7LM22 B1AHQ9 Q6I9W3 CENP-M
Symbols PANE1
CENP-M
C22orf18

Gene

PDB

4P0T   4WAU  

Gene RIF (5)

PMID Text
25006165 CENP-M is crucially required for the assembly and stability of a tetramer also comprising CENP-I, CENP-H, and CENP-K, the HIKM complex, which we extensively characterize through a combination of structural, biochemical, and cell biological approaches.
19773279 Observational study of gene-disease association. (HuGE Navigator)
16622419 PANE1 localizes to the centromere throughout the cell cycle and its localization is dependent on the centromere specific histone variant CENP-A.
16391015 an alternative transcript of the proliferation-associated nuclear element 1 (PANE1) gene encodes a novel (HLA)-A(*)0301-restricted mHAg that is selectively expressed in B-lymphoid cells
15183305 Expression of the human PANE1 gene was detected preferentially in immune cells

AA Sequence

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV      1 - 70
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA     71 - 140
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL                                  141 - 180
//

Text Mined References (19)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25006165 2014 The pseudo GTPase CENP-M drives human kinetochore assembly.
24553122 2014 Acquired resistance to metformin in breast cancer cells triggers transcriptome reprogramming toward a degradome-related metastatic stem-like profile.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
21269460 2011 Initial characterization of the human central proteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19533115 2009 Acceptor-photobleaching FRET analysis of core kinetochore and NAC proteins in living human cells.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
More...