Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.78
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV      1 - 70
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA     71 - 140
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL                                  141 - 180
//

Text Mined References (19)

PMID Year Title