Property Summary

NCBI Gene PubMed Count 26
Grant Count 9
R01 Count 7
Funding $670,649.89
PubMed Score 27.87
PubTator Score 18.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

 GO Process (1)

Gene RIF (6)

PMID Text
21358174 Brain-specific gamma1-syntrophin participates in gamma-enolase translocation towards the plasma membrane, a pre-requisite for its neurotrophic activity.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19836389 Includes a comparison of the Drosophila and human syntrophin proteins.
15088139 Observational study of genotype prevalence. (HuGE Navigator)
10747910 suggests a differentiated role of a modified dystrophin-associated complex in the central nervous system

AA Sequence

MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGL      1 - 70
SIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK     71 - 140
RAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP    141 - 210
LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPV    211 - 280
NQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL    281 - 350
LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF    351 - 420
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL    421 - 490
DPLFLGNQATASTAASSATTSKAKYTT                                               491 - 517
//

Text Mined References (27)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21358174 2010 ?-1-syntrophin mediates trafficking of ?-enolase towards the plasma membrane and enhances its neurotrophic activity.
21314952 2011 Bioinformatic analyses identifies novel protein-coding pharmacogenomic markers associated with paclitaxel sensitivity in NCI60 cancer cell lines.
21151896 2010 Genomic aberrations in lung adenocarcinoma in never smokers.
20838928 2011 Population and computational analysis of the MGEA6 P521A variation as a risk factor for familial idiopathic basal ganglia calcification (Fahr's disease).
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19836389 2010 Syntrophin-2 is required for eye development in Drosophila.
More...