Property Summary

NCBI Gene PubMed Count 26
PubMed Score 29.10
PubTator Score 18.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 5.8e-05
atypical teratoid / rhabdoid tumor -2.000 6.0e-04
ependymoma -2.300 3.8e-08
group 3 medulloblastoma -2.500 9.2e-04
lung carcinoma 3.200 1.2e-28
medulloblastoma, large-cell -2.300 3.6e-04
progressive supranuclear palsy 1.100 4.3e-02

Synonym

Accession Q9NSN8 Q2M3Q0 Q9NY98 G1SYN
Symbols SYN4
G1SYN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (6)

AA Sequence

MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGL      1 - 70
SIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK     71 - 140
RAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP    141 - 210
LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPV    211 - 280
NQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL    281 - 350
LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF    351 - 420
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL    421 - 490
DPLFLGNQATASTAASSATTSKAKYTT                                               491 - 517
//

Text Mined References (27)

PMID Year Title