Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.57
PubTator Score 26.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 8.2e-06
astrocytic glioma -1.800 4.6e-03
atypical teratoid / rhabdoid tumor -1.400 1.8e-09
breast carcinoma -1.500 4.3e-04
ductal carcinoma in situ -1.900 5.6e-04
ependymoma -1.800 8.9e-03
fibroadenoma -1.700 2.4e-02
glioblastoma -1.500 5.7e-06
invasive ductal carcinoma -1.900 5.6e-03
medulloblastoma, large-cell -1.400 6.2e-05
oligodendroglioma -1.900 6.2e-03
osteosarcoma 2.486 6.3e-05
ovarian cancer 1.500 8.2e-05
pancreatic ductal adenocarcinoma liver m... -1.167 2.9e-03

Gene RIF (12)

AA Sequence

MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGG      1 - 70
LLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYV     71 - 140
TKELRAEIQYDD                                                              141 - 152
//

Text Mined References (27)

PMID Year Title