Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
R01 Count 2
Funding $102,382.71
PubMed Score 1.10
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.998 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001

Synonym

Accession Q9NSK0 B3KNY4 B3KPI3 B3KSQ3 B4DME9 Q66K28 Q96EG6 KLC 4
Symbols KNSL8
bA387M24.3

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
26423925 The association of a KLC4 mutation with spastic paraplegia identifies a new locus for the disease.
20818331 Data reveal aspects of the molecular mechanism of kinesin-8 motors that contribute to their unique dual motile and depolymerising functions, which are adapted to control microtubule length.

AA Sequence

MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHEEGLVHEKARQ      1 - 70
LRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQL     71 - 140
EEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSLDDLFPNEEEEDPSNGLSRGQGATAAQQGGYEIPAR    141 - 210
LRTLHNLVIQYAAQGRYEVAVPLCKQALEDLERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDAL    211 - 280
SIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQ    281 - 350
GKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD    351 - 420
HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECA    421 - 490
LRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVEWSGDGSGTLQRSGSLGKIRD    491 - 560
VLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPSAAPLQVSRGLSASTMDLSSSS               561 - 619
//

Text Mined References (27)

PMID Year Title
26423925 2015 Hereditary spastic paraplegia with recessive trait caused by mutation in KLC4 gene.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20818331 2010 Insight into the molecular mechanism of the multitasking kinesin-8 motor.
More...