Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.87
PubTator Score 193.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 1.7e-02
aldosterone-producing adenoma -1.173 3.3e-02
Astrocytoma, Pilocytic 2.000 1.1e-05
Atopic dermatitis 1.500 1.1e-02
cutaneous lupus erythematosus 3.000 6.9e-04
glioblastoma 1.100 2.5e-03
group 4 medulloblastoma -1.400 1.3e-02
interstitial cystitis 2.000 2.6e-03
intraductal papillary-mucinous adenoma (... -1.600 4.3e-02
intraductal papillary-mucinous carcinoma... -2.200 4.8e-03
invasive ductal carcinoma 1.708 6.8e-03
lung cancer -2.300 1.1e-03
lung carcinoma -1.500 6.0e-07
malignant mesothelioma -1.500 6.5e-06
medulloblastoma, large-cell -1.700 2.9e-02
non-small cell lung cancer -1.135 2.7e-08
ovarian cancer -1.600 5.4e-03
periodontitis 1.300 1.7e-19
posterior fossa group A ependymoma 1.300 7.8e-03
primary Sjogren syndrome 1.500 9.8e-04
psoriasis 1.700 1.9e-23
Rheumatoid arthritis 1.600 1.2e-02
tuberculosis -2.200 8.9e-05
ulcerative colitis 2.200 1.2e-04

Gene RIF (8)

AA Sequence

MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKM      1 - 70
RAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGIT     71 - 140
SCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNK    141 - 210
VGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESH    211 - 280
LIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNG    281 - 350
KEDLESENLSDMVHKIIITEPSD                                                   351 - 373
//

Text Mined References (21)

PMID Year Title