Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.03
PubTator Score 193.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25805236 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25117979 This is the first study to identify deletion of a key gene in the C57BL/KaLwRij mice that also displays reduced gene expression in patients with MM and is therefore likely to play an integral role in MM disease development.
24278465 High expression of SAMSN1 is a significant risk factor for the progression free and overall survival of glioblastoma multiforme
21296879 the immunoinhibitory roles of SLy2 in vivo and suggest that the physiological up-regulation of SLy2 observed upon B cell activation functions to counteract excessive B cell spreading.
20478393 In the nucleus, SLy2 interacts with the SAP30/HDAC1 complex and regulates the activity of HDAC1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18523997 downregulation of SAMSN1 gene in human lung cancer.
15381729 HACS1 is up-regulated by B cell activation signals and is a participant in B cell activation and differentiation.

AA Sequence

MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKM      1 - 70
RAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGIT     71 - 140
SCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNK    141 - 210
VGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESH    211 - 280
LIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNG    281 - 350
KEDLESENLSDMVHKIIITEPSD                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
25805236 2015 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25117979 2014 SAMSN1 is a tumor suppressor gene in multiple myeloma.
24278465 2013 SAMSN1 is highly expressed and associated with a poor survival in glioblastoma multiforme.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21296879 2011 Immunoinhibitory adapter protein Src homology domain 3 lymphocyte protein 2 (SLy2) regulates actin dynamics and B cell spreading.
21269460 2011 Initial characterization of the human central proteome.
20478393 2010 SLy2 targets the nuclear SAP30/HDAC1 complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...