Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.03
PubTator Score 193.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 1.06256435925114E-79
periodontitis 269 1.73513885715619E-19
non-small cell lung cancer 2798 7.78320551595718E-10
ulcerative colitis 2087 1.16679290343805E-7
lung carcinoma 2844 5.99416683619082E-7
interstitial cystitis 2299 7.56078975745265E-7
malignant mesothelioma 3163 6.51334489102661E-6
pilocytic astrocytoma 3086 1.46926132223203E-5
lung cancer 4473 1.51015379453549E-5
tuberculosis 1563 8.93607832488805E-5
glioblastoma 5572 1.36530383122765E-4
ovarian cancer 8492 6.09711275568344E-4
primary Sjogren syndrome 789 6.55313239191528E-4
cutaneous lupus erythematosus 1056 6.88780151097246E-4
pediatric high grade glioma 2712 0.00424764195767826
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0047955995829281
posterior fossa group A ependymoma 1511 0.00775866570339058
Atopic dermatitis 944 0.0108167196915248
Rheumatoid Arthritis 1171 0.0117755752171079
group 4 medulloblastoma 1875 0.0129156667464795
invasive ductal carcinoma 2950 0.0202599473596521
medulloblastoma, large-cell 6234 0.0290699461534539
aldosterone-producing adenoma 664 0.033048039423105
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0426742284364917
Disease Target Count Z-score Confidence
Monoclonal gammopathy of uncertain significance 5 3.028 1.5

Expression

Synonym

Accession Q9NSI8 B3KWJ3 F8WAA1 Q8NFF7 Q9C041
Symbols SLy2
HACS1
NASH1
SASH2
SH3D6B

Gene

PDB

2KEA  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (8)

PMID Text
25805236 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25117979 This is the first study to identify deletion of a key gene in the C57BL/KaLwRij mice that also displays reduced gene expression in patients with MM and is therefore likely to play an integral role in MM disease development.
24278465 High expression of SAMSN1 is a significant risk factor for the progression free and overall survival of glioblastoma multiforme
21296879 the immunoinhibitory roles of SLy2 in vivo and suggest that the physiological up-regulation of SLy2 observed upon B cell activation functions to counteract excessive B cell spreading.
20478393 In the nucleus, SLy2 interacts with the SAP30/HDAC1 complex and regulates the activity of HDAC1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18523997 downregulation of SAMSN1 gene in human lung cancer.
15381729 HACS1 is up-regulated by B cell activation signals and is a participant in B cell activation and differentiation.

AA Sequence

MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKM      1 - 70
RAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGIT     71 - 140
SCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNK    141 - 210
VGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESH    211 - 280
LIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNG    281 - 350
KEDLESENLSDMVHKIIITEPSD                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
25805236 2015 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25117979 2014 SAMSN1 is a tumor suppressor gene in multiple myeloma.
24278465 2013 SAMSN1 is highly expressed and associated with a poor survival in glioblastoma multiforme.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21296879 2011 Immunoinhibitory adapter protein Src homology domain 3 lymphocyte protein 2 (SLy2) regulates actin dynamics and B cell spreading.
21269460 2011 Initial characterization of the human central proteome.
20478393 2010 SLy2 targets the nuclear SAP30/HDAC1 complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...