Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $275,729.34
PubMed Score 6.56
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma 1.500 0.000
glioblastoma 1.700 0.006
atypical teratoid / rhabdoid tumor 1.200 0.003
adult high grade glioma 1.600 0.000
pilocytic astrocytoma 1.800 0.000
pituitary cancer 1.800 0.000
psoriasis -2.000 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNCTVSQGWKLIM      1 - 70
WALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTVQV     71 - 140
MGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSN    141 - 210
GTLTCVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPT    211 - 280
CTLTIRCCCCRRRCCGCNCCCRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTD    281 - 350
TASLPPKSCESSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV                 351 - 407
//

Text Mined References (9)

PMID Year Title
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
22042635 2012 Antibody-based protein profiling of the human chromosome 21.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773569 2003 JAM4, a junctional cell adhesion molecule interacting with a tight junction protein, MAGI-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.