Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.70
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.7
Parkinson's disease 392 0.0 1.2

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.600 2.4e-04
Astrocytoma, Pilocytic 1.800 1.7e-07
atypical teratoid / rhabdoid tumor 1.200 2.9e-03
ependymoma 1.400 4.1e-07
glioblastoma 1.400 1.7e-04
pituitary cancer 1.800 1.2e-06
psoriasis -2.000 3.7e-21

Gene RIF (1)

AA Sequence

MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNCTVSQGWKLIM      1 - 70
WALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTVQV     71 - 140
MGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSN    141 - 210
GTLTCVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPT    211 - 280
CTLTIRCCCCRRRCCGCNCCCRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTD    281 - 350
TASLPPKSCESSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV                 351 - 407
//

Text Mined References (9)

PMID Year Title