Tbio | Cytokine-inducible SH2-containing protein |
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).
The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Comments
Disease | Target Count |
---|---|
Dermatitis, Allergic Contact | 66 |
MYCOBACTERIUM TUBERCULOSIS, SUSCEPTIBILITY TO (finding) | 12 |
Malaria | 140 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 5.23524959121202E-11 |
pituitary cancer | 1972 | 4.91662265003115E-9 |
adult high grade glioma | 2148 | 5.35580383671656E-6 |
lung cancer | 4473 | 2.08480026786774E-4 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 2.88482699130665E-4 |
hepatocellular carcinoma | 550 | 0.00409121335196313 |
breast carcinoma | 1614 | 0.00633343401380939 |
osteosarcoma | 7933 | 0.0117877421890535 |
Disease | log2 FC | p |
---|---|---|
hepatocellular carcinoma | 1.200 | 0.004 |
osteosarcoma | -1.039 | 0.012 |
pancreatic ductal adenocarcinoma liver m... | -1.740 | 0.000 |
non-small cell lung cancer | -1.061 | 0.000 |
lung cancer | -1.600 | 0.000 |
breast carcinoma | 1.700 | 0.006 |
adult high grade glioma | 1.300 | 0.000 |
pituitary cancer | -2.100 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
25460819 | Study in Chinese Han population confirms that previously identified variants of CISH are associated with susceptibility to pulmonary tuberculosis. |
25448846 | Data indicate that CIS protein stability is regulated through multiple mechanisms, including ubiquitination and interaction with Elongin B/C proteins, whereas CIS functional inhibition of PRLR signaling is dependent on the Elongin B/C interaction. |
25286386 | This study showed that there was significantly increased levels of CIS mRNA in elderly and Alzheimer's disease brains. |
25104439 | SOCS single nucleotide polymorphism is associated with breast cancer. |
24964072 | Two SNPs (rs414171 and rs2239751) in the CISH gene were associated with persistent HBV infection in Han Chinese population |
24791876 | CISH gene polymorphisms at -292 (rs414171) are associated with HBV clearance in HBeAg-positive CHB patients in the immune active phase, and AA is a favorable genotype for this effect. |
24632804 | CISH promoter rs414171 and rs809451 polymorphisms may play a vital role in mediating individual susceptibility to tuberculosis |
24131863 | methylation of SOCS1, SOCS2, SOCS3 and CISH is infrequent in Ph-ve MPN. |
23949851 | two genetic variants in CISH gene appear to increase susceptibility to TB in Chinese Han population |
23898208 | HIV-1 Tat upregulates the expression of cytokine inducible SH2-containing protein (CISH) in human primary T cells |
More... |
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI 1 - 70 AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL 71 - 140 DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL 141 - 210 VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL 211 - 258 //
PMID | Year | Title |
---|---|---|
25460819 | 2014 | Polymorphisms in the CISH gene are associated with susceptibility to tuberculosis in the Chinese Han population. |
25448846 | 2015 | Regulation of cytokine-inducible SH2-containing protein (CIS) by ubiquitination and Elongin B/C interaction. |
25286386 | 2015 | Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia. |
25104439 | 2014 | Genetic variation in the JAK/STAT/SOCS signaling pathway influences breast cancer-specific mortality through interaction with cigarette smoking and use of aspirin/NSAIDs: the Breast Cancer Health Disparities Study. |
24964072 | 2014 | Polymorphisms in CISH gene are associated with persistent hepatitis B virus infection in Han Chinese population. |
24791876 | 2014 | Association between CISH polymorphisms and spontaneous clearance of hepatitis B virus in hepatitis B extracellular antigen-positive patients during immune active phase. |
24658140 | 2014 | The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells. |
24632804 | 2014 | Genetic contribution of CISH promoter polymorphisms to susceptibility to tuberculosis in Chinese children. |
24131863 | 2013 | Methylation profiling of SOCS1, SOCS2, SOCS3, CISH and SHP1 in Philadelphia-negative myeloproliferative neoplasm. |
23949851 | 2014 | Association between single-nucleotide polymorphism in CISH gene and susceptibility to tuberculosis in Chinese Han population. |
More... |