Property Summary

NCBI Gene PubMed Count 52
PubMed Score 780.89
PubTator Score 405.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.300 5.4e-06
breast carcinoma 1.700 6.3e-03
hepatocellular carcinoma 1.200 4.1e-03
lung cancer -1.400 8.3e-03
non-small cell lung cancer -1.061 5.2e-11
osteosarcoma -1.039 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.740 2.9e-04
pituitary cancer -1.600 1.0e-07

Protein-protein Interaction (2)

Gene RIF (34)

AA Sequence

MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI      1 - 70
AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL     71 - 140
DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL    141 - 210
VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL                          211 - 258
//

Text Mined References (54)

PMID Year Title