Property Summary

NCBI Gene PubMed Count 49
Grant Count 357
R01 Count 215
Funding $32,365,848.52
PubMed Score 723.71
PubTator Score 405.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.004
osteosarcoma -1.039 0.012
pancreatic ductal adenocarcinoma liver m... -1.740 0.000
non-small cell lung cancer -1.061 0.000
lung cancer -1.600 0.000
breast carcinoma 1.700 0.006
adult high grade glioma 1.300 0.000
pituitary cancer -2.100 0.000

Synonym

Accession Q9NSE2 B2R9N1 G5E9R1 Q9NS38 Q9Y5R1 CIS
Symbols CIS
G18
SOCS
CIS-1
BACTS2

Gene

Gene RIF (30)

PMID Text
25460819 Study in Chinese Han population confirms that previously identified variants of CISH are associated with susceptibility to pulmonary tuberculosis.
25448846 Data indicate that CIS protein stability is regulated through multiple mechanisms, including ubiquitination and interaction with Elongin B/C proteins, whereas CIS functional inhibition of PRLR signaling is dependent on the Elongin B/C interaction.
25286386 This study showed that there was significantly increased levels of CIS mRNA in elderly and Alzheimer's disease brains.
25104439 SOCS single nucleotide polymorphism is associated with breast cancer.
24964072 Two SNPs (rs414171 and rs2239751) in the CISH gene were associated with persistent HBV infection in Han Chinese population
24791876 CISH gene polymorphisms at -292 (rs414171) are associated with HBV clearance in HBeAg-positive CHB patients in the immune active phase, and AA is a favorable genotype for this effect.
24632804 CISH promoter rs414171 and rs809451 polymorphisms may play a vital role in mediating individual susceptibility to tuberculosis
24131863 methylation of SOCS1, SOCS2, SOCS3 and CISH is infrequent in Ph-ve MPN.
23949851 two genetic variants in CISH gene appear to increase susceptibility to TB in Chinese Han population
23898208 HIV-1 Tat upregulates the expression of cytokine inducible SH2-containing protein (CISH) in human primary T cells
More...

AA Sequence

MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI      1 - 70
AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL     71 - 140
DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL    141 - 210
VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL                          211 - 258
//

Text Mined References (51)

PMID Year Title
25460819 2014 Polymorphisms in the CISH gene are associated with susceptibility to tuberculosis in the Chinese Han population.
25448846 2015 Regulation of cytokine-inducible SH2-containing protein (CIS) by ubiquitination and Elongin B/C interaction.
25286386 2015 Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia.
25104439 2014 Genetic variation in the JAK/STAT/SOCS signaling pathway influences breast cancer-specific mortality through interaction with cigarette smoking and use of aspirin/NSAIDs: the Breast Cancer Health Disparities Study.
24964072 2014 Polymorphisms in CISH gene are associated with persistent hepatitis B virus infection in Han Chinese population.
24791876 2014 Association between CISH polymorphisms and spontaneous clearance of hepatitis B virus in hepatitis B extracellular antigen-positive patients during immune active phase.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24632804 2014 Genetic contribution of CISH promoter polymorphisms to susceptibility to tuberculosis in Chinese children.
24131863 2013 Methylation profiling of SOCS1, SOCS2, SOCS3, CISH and SHP1 in Philadelphia-negative myeloproliferative neoplasm.
23949851 2014 Association between single-nucleotide polymorphism in CISH gene and susceptibility to tuberculosis in Chinese Han population.
More...