Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.01
PubTator Score 28.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor 1.100 0.004
non primary Sjogren syndrome sicca -1.100 0.023
Pick disease -1.200 0.000
acute myeloid leukemia -1.200 0.020

Synonym

Accession Q9NSD9 B4DFM0 O95708 Q4ZFX1 Q57ZJ5 Q9NZZ6
Symbols FRSB
PheHB
PheRS
FARSLB
HSPC173

Gene

PDB

3L4G  

Gene RIF (3)

PMID Text
22137894 Human PheRS recognizes C74, the G1-C72 base pair, and the "discriminator" base A73, proposed to contribute to tRNA(Phe) identity in the yeast mitochondrial enzyme.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223217 Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns

AA Sequence

MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPAN      1 - 70
RYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFI     71 - 140
ELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHY    141 - 210
LHIIENKPLYPVIYDSNGVVLSMPPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCEN    211 - 280
QFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIE    281 - 350
IPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ    351 - 420
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDIVIKDSNTDVG    421 - 490
AKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEGPAFFPGRCAEIFARGQSVGK    491 - 560
LGVLHPDVITKFELTMPCSSLEINVGPFL                                             561 - 589
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22137894 2012 Crystal structure of human mitochondrial PheRS complexed with tRNA(Phe) in the active "open" state.
21596488 2012 Use of germline polymorphisms in predicting concurrent chemoradiotherapy response in esophageal cancer.
21269460 2011 Initial characterization of the human central proteome.
20433702 2010 HSP60, a protein downregulated by IGFBP7 in colorectal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20223217 2010 Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
19946888 2010 Defining the membrane proteome of NK cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...