Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.02
PubTator Score 28.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rigid spine muscular dystrophy 1 14 3.543 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.200 2.0e-02
non primary Sjogren syndrome sicca -1.100 2.3e-02
Pick disease -1.200 2.7e-04
primitive neuroectodermal tumor 1.100 4.1e-03

Protein-protein Interaction (9)

Gene RIF (3)

AA Sequence

MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPAN      1 - 70
RYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFI     71 - 140
ELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHY    141 - 210
LHIIENKPLYPVIYDSNGVVLSMPPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCEN    211 - 280
QFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIE    281 - 350
IPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ    351 - 420
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDIVIKDSNTDVG    421 - 490
AKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEGPAFFPGRCAEIFARGQSVGK    491 - 560
LGVLHPDVITKFELTMPCSSLEINVGPFL                                             561 - 589
//

Text Mined References (24)

PMID Year Title