Property Summary

NCBI Gene PubMed Count 18
PubMed Score 49.34
PubTator Score 32.49

Knowledge Summary

Patent (9,028)

Synonym

Accession Q9NSD7 Q14DA5 RLN3 receptor 1
Symbols SALPR
RLN3R1
RXFPR3
GPCR135

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (11)

PMID Text
24641548 we demonstrated distinct patterns of signalling for H3 and H2 relaxin and R3(BDelta23-27)R/I5 at the RXFP3 receptor
24615237 Glu141 and Asp145 of the RXFP3 interact with the highly conserved arginine residues of relaxin-3.
22347403 demonstrate the existence of an allosteric site for modulation of RXFP3
20211485 Methylation status of CIDEA, HAAO and RXFP3 had significant association with microsatellite instability in endometrial tumors.
20159943 H3 relaxin potently activates all signaling pathways coupled to RXFP3, whereas H2 relaxin is an AP-1-biased ligand relative to H3 relaxin.
19152634 Results decribe the structural and functional aspects of the interaction between relaxin-3 and its receptor, RXFP3.
18582868 the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation.
18434306 analysis of truncated human relaxin-2 and -3 (H2 and H3) relaxin peptides and their binding and cAMP activities on RXFP1, RXFP2, and RXFP3
15956730 functional response to H3 relaxin and other relaxin/insulin peptides of GPCR135 expressed in CHO-K1 cells was measured in the cytosensor microphysiometer and analyzed using inhibitors of signal transduction proteins
15465925 Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142.
More...

AA Sequence

MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGAPPGHPPGSGG      1 - 70
AESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLFVTNLALTDFQFVLTLPFWAV     71 - 140
ENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTRYHSVASALKSHRTRGHGRGDCCGRSLGDSC    141 - 210
CFSAKALCVWIWALAALASLPSAIFSTTVKVMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPL    211 - 280
GIIILCYLLLVRFIADRRAAGTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSI    281 - 350
LIKFNAVPFSQEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA    351 - 420
TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY                         421 - 469
//

Text Mined References (18)

PMID Year Title
24641548 2014 Signalling profiles of H3 relaxin, H2 relaxin and R3(B?23-27)R/I5 acting at the relaxin family peptide receptor 3 (RXFP3).
24615237 2014 The highly conserved negatively charged Glu141 and Asp145 of the G-protein-coupled receptor RXFP3 interact with the highly conserved positively charged arginine residues of relaxin-3.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22347403 2012 In vitro pharmacological characterization of RXFP3 allosterism: an example of probe dependency.
20211485 2010 Promoter hypermethylation of CIDEA, HAAO and RXFP3 associated with microsatellite instability in endometrial carcinomas.
20159943 2010 H2 relaxin is a biased ligand relative to H3 relaxin at the relaxin family peptide receptor 3 (RXFP3).
19152634 2009 The structural and functional role of the B-chain C-terminal arginine in the relaxin-3 peptide antagonist, R3(BDelta23-27)R/I5.
18582868 2008 Identification of the domains in RXFP4 (GPCR142) responsible for the high affinity binding and agonistic activity of INSL5 at RXFP4 compared to RXFP3 (GPCR135).
18434306 2008 The A-chain of human relaxin family peptides has distinct roles in the binding and activation of the different relaxin family peptide receptors.
16507880 2006 International Union of Pharmacology LVII: recommendations for the nomenclature of receptors for relaxin family peptides.
More...