Property Summary

NCBI Gene PubMed Count 24
PubMed Score 259.16
PubTator Score 33.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 1.5e-04
astrocytoma -1.200 2.5e-15
atypical teratoid / rhabdoid tumor -1.800 9.4e-03
ependymoma 1.100 5.3e-03
glioblastoma -1.700 2.4e-04
group 3 medulloblastoma -1.400 1.5e-02
medulloblastoma, large-cell -2.700 2.4e-05
oligodendroglioma -1.300 3.4e-13
osteosarcoma 1.065 6.4e-04
ovarian cancer 1.500 1.7e-11
Pick disease 1.100 4.0e-02
primitive neuroectodermal tumor -1.900 1.1e-03
psoriasis -1.300 4.6e-09

Gene RIF (12)

AA Sequence

MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAF      1 - 70
FIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQMIVILLNVYYIIVLAWALFYL     71 - 140
FSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENATSPVIEFWERRVLKISDGIQHLGALRWELAL    141 - 210
CLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWM    211 - 280
DAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEV    281 - 350
AESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI    351 - 420
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNIEDMIGYRPWP    421 - 490
LIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALSSMVCIPAWSLYRLGTLKGPF    491 - 560
RERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELESHC                                561 - 602
//

Text Mined References (27)

PMID Year Title