Property Summary

NCBI Gene PubMed Count 24
Grant Count 29
R01 Count 19
Funding $2,542,149.17
PubMed Score 242.53
PubTator Score 33.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -2.500 0.000
oligodendroglioma -1.300 0.000
osteosarcoma 1.065 0.001
posterior fossa group B ependymoma 3.800 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.009
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.900 0.001
pediatric high grade glioma -2.100 0.000
Pick disease 1.100 0.040
ovarian cancer 1.500 0.000
psoriasis -1.300 0.000

Gene RIF (12)

PMID Text
25824654 Evidence for a Revised Ion/Substrate Coupling Stoichiometry of GABA Transporters.
24842606 Neurotransmitter transporters including SLC6A6 and SLC6A13 mediate the uptake of 5-aminolevulinic acid (ALA) and can play roles in the enhancement of ALA-induced accumulation of protoporphyrin in cancerous cells.
22932902 Results suggest that gamma-aminobutyric acid transporter 2 GAT-2 is a high selectivity/low affinity transporter.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAF      1 - 70
FIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQMIVILLNVYYIIVLAWALFYL     71 - 140
FSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENATSPVIEFWERRVLKISDGIQHLGALRWELAL    141 - 210
CLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWM    211 - 280
DAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEV    281 - 350
AESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI    351 - 420
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNIEDMIGYRPWP    421 - 490
LIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALSSMVCIPAWSLYRLGTLKGPF    491 - 560
RERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELESHC                                561 - 602
//

Text Mined References (27)

PMID Year Title
25824654 2015 Evidence for a Revised Ion/Substrate Coupling Stoichiometry of GABA Transporters.
24842606 Neurotransmitter transporter family including SLC6A6 and SLC6A13 contributes to the 5-aminolevulinic acid (ALA)-induced accumulation of protoporphyrin IX and photodamage, through uptake of ALA by cancerous cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
22932902 2012 High selectivity of the ?-aminobutyric acid transporter 2 (GAT-2, SLC6A13) revealed by structure-based approach.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
More...