Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 2.5e-02
glioblastoma 1.200 2.2e-03
oligodendroglioma 1.300 7.1e-03
osteosarcoma 2.838 4.0e-07
ovarian cancer -1.500 1.0e-06
pancreatic ductal adenocarcinoma liver m... -1.094 7.9e-03
periodontitis 1.200 1.6e-23
subependymal giant cell astrocytoma -1.051 2.8e-02
ulcerative colitis 1.100 4.8e-05

AA Sequence

MMSHPCVSLLGVPVLNPALVPHLAQGQVLLVSDPSPNTDPAKYSESTSATRHQMKGEDAQPQEMASTSFP      1 - 70
RASGPSPEFRQHGDSDGKRGSPQNLPIEHHFACKECGDTFRLKVLLVQHQRVHSEEKGWECGDCGKVFRG     71 - 140
VAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFD    141 - 210
CEECGRSFKVNTHLFRHQKLHTSEKPFACKACSRDFLDRQELLKHQRMHTGHLPFDCDDCGKSFRGVNGL    211 - 280
AEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYACGQCGKAFRQSSSLLEHARIHSGERPYA    281 - 350
CGECGKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSSGLSRHRRIHSGARRCECSQCGRVFKRRSAL    351 - 420
QKHQPTHHE                                                                 421 - 429
//

Text Mined References (7)

PMID Year Title