Tbio | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 |
Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins (Ikehara et al., 1999 [PubMed 10536037]; Sewell et al., 2006 [PubMed 16319059]).[supplied by OMIM, Mar 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 2.54350125320613E-81 |
lung adenocarcinoma | 2714 | 7.91522631920145E-11 |
non-small cell lung carcinoma | 413 | 9.55841556360308E-11 |
nasopharyngeal carcinoma | 1056 | 2.60813115386764E-5 |
atypical teratoid / rhabdoid tumor | 4369 | 4.79552425519148E-5 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 8.31620195089778E-5 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 1.59641188375885E-4 |
pancreatic cancer | 2300 | 4.06832977229322E-4 |
ovarian cancer | 8492 | 6.28218356263884E-4 |
medulloblastoma, large-cell | 6234 | 0.00257520930023788 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00315564312536561 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Newcastle disease | 13 | 3.279 | 1.6 |
Disease | log2 FC | p |
---|---|---|
atypical teratoid / rhabdoid tumor | -1.200 | 0.000 |
medulloblastoma, large-cell | -1.400 | 0.003 |
intraductal papillary-mucinous adenoma (... | 4.600 | 0.000 |
intraductal papillary-mucinous carcinoma... | 4.800 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 4.300 | 0.003 |
pancreatic cancer | 2.500 | 0.000 |
lung adenocarcinoma | 1.400 | 0.000 |
psoriasis | 2.000 | 0.000 |
nasopharyngeal carcinoma | -2.600 | 0.000 |
non-small cell lung carcinoma | 1.200 | 0.000 |
ovarian cancer | 2.400 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Platypus | EggNOG Inparanoid |
Chicken | EggNOG Inparanoid |
PMID | Text |
---|---|
25860962 | upregulated Siat7A expression, which was paralleled by the increased Klf4 in the ischemic myocardium, contributed to cardiomyocyte apoptosis following myocardial infarction |
24840470 | Using qRT-PCR, sialyl-Tn expression was found to be associated with an increase in alpha2,6-sialyltransferase gene (ST6GALNAC1) and a decrease in core 1 synthase gene (C1GALT1) in LS174T cells. |
22228572 | It was confirmed that MUC1 carries sialyl Tn also in human advanced gastric cancer tissues |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
20378551 | Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells |
19287074 | Expression of ppGalNAc-T6 is significantly higher in breast cancer compared to 'normal'/benign breast tissue samples. ST6GalNAc-I expression in breast cancer is associated with better prognosis. |
16319059 | ST6GalNAc-I sialyltransferase localizes throughout the Golgi and has a role in synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer |
12820722 | The stable transfection of MDA-MB-231 with an expression vector encoding ST6GalNAc I induces the expression of STn antigen at the cell surface. |
MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLAKPKSQAPTRA 1 - 70 RRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPR 71 - 140 GQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAV 141 - 210 STRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCP 211 - 280 DSVKIKASKSLWLQKLFLPNLTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQL 281 - 350 LLASLPAGSLRCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ 351 - 420 SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFREALHMDRYLL 421 - 490 LHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYGFITEGHERFSDHYYDTSWKR 491 - 560 LIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN 561 - 600 //
PMID | Year | Title |
---|---|---|
25860962 | 2015 | Sialyltransferase7A, a Klf4-responsive gene, promotes cardiomyocyte apoptosis during myocardial infarction. |
24840470 | 2014 | Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies. |
22228572 | 2012 | Enhancement of metastatic ability by ectopic expression of ST6GalNAcI on a gastric cancer cell line in a mouse model. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
20378551 | 2010 | Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells. |
19287074 | Prognostic utility of glycosyltransferase expression in breast cancer. | |
17081983 | 2006 | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
16319059 | 2006 | The ST6GalNAc-I sialyltransferase localizes throughout the Golgi and is responsible for the synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer. |
12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. |
More... |