Property Summary

NCBI Gene PubMed Count 15
PubMed Score 98.19
PubTator Score 56.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.54350125320613E-81
lung adenocarcinoma 2714 7.91522631920145E-11
non-small cell lung carcinoma 413 9.55841556360308E-11
nasopharyngeal carcinoma 1056 2.60813115386764E-5
atypical teratoid / rhabdoid tumor 4369 4.79552425519148E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.31620195089778E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.59641188375885E-4
pancreatic cancer 2300 4.06832977229322E-4
ovarian cancer 8492 6.28218356263884E-4
medulloblastoma, large-cell 6234 0.00257520930023788
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00315564312536561
Disease Target Count Z-score Confidence
Newcastle disease 13 3.279 1.6

Expression

Synonym

Accession Q9NSC7 Q6UW90 Q9NSC6
Symbols STYI
SIAT7A
HSY11339
ST6GalNAcI

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Gene RIF (8)

PMID Text
25860962 upregulated Siat7A expression, which was paralleled by the increased Klf4 in the ischemic myocardium, contributed to cardiomyocyte apoptosis following myocardial infarction
24840470 Using qRT-PCR, sialyl-Tn expression was found to be associated with an increase in alpha2,6-sialyltransferase gene (ST6GALNAC1) and a decrease in core 1 synthase gene (C1GALT1) in LS174T cells.
22228572 It was confirmed that MUC1 carries sialyl Tn also in human advanced gastric cancer tissues
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378551 Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells
19287074 Expression of ppGalNAc-T6 is significantly higher in breast cancer compared to 'normal'/benign breast tissue samples. ST6GalNAc-I expression in breast cancer is associated with better prognosis.
16319059 ST6GalNAc-I sialyltransferase localizes throughout the Golgi and has a role in synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer
12820722 The stable transfection of MDA-MB-231 with an expression vector encoding ST6GalNAc I induces the expression of STn antigen at the cell surface.

AA Sequence

MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLAKPKSQAPTRA      1 - 70
RRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPR     71 - 140
GQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAV    141 - 210
STRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCP    211 - 280
DSVKIKASKSLWLQKLFLPNLTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQL    281 - 350
LLASLPAGSLRCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ    351 - 420
SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFREALHMDRYLL    421 - 490
LHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYGFITEGHERFSDHYYDTSWKR    491 - 560
LIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN                                  561 - 600
//

Text Mined References (15)

PMID Year Title
25860962 2015 Sialyltransferase7A, a Klf4-responsive gene, promotes cardiomyocyte apoptosis during myocardial infarction.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
22228572 2012 Enhancement of metastatic ability by ectopic expression of ST6GalNAcI on a gastric cancer cell line in a mouse model.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378551 2010 Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells.
19287074 Prognostic utility of glycosyltransferase expression in breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319059 2006 The ST6GalNAc-I sialyltransferase localizes throughout the Golgi and is responsible for the synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...