Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.55
PubTator Score 9.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 1.1e-15
Breast cancer 1.200 8.1e-06
cystic fibrosis and chronic rhinosinusit... 1.007 2.3e-02
dermatomyositis -1.100 1.8e-02
Gaucher disease type 1 -1.100 4.9e-02
glioblastoma multiforme 1.400 2.9e-25
malignant mesothelioma -1.500 9.7e-07
nasopharyngeal carcinoma 1.200 4.7e-03
non-small cell lung cancer 1.131 1.5e-15
ovarian cancer 1.300 1.2e-04
psoriasis 1.100 2.3e-06

Gene RIF (8)

AA Sequence

MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF      1 - 70
TKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPALGLASHQVPP     71 - 140
SPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAA    141 - 210
AQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGG    211 - 280
PREALEAAEREETQQKVQDLETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELR    281 - 350
EGLARLAEAAP                                                               351 - 361
//

Text Mined References (27)

PMID Year Title