Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 9
Funding $869,362.75
PubMed Score 13.40
PubTator Score 9.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis 2.700 0.000
astrocytoma 1.100 0.000
glioblastoma multiforme 1.400 0.000
non-small cell lung cancer 1.131 0.000
nasopharyngeal carcinoma 1.200 0.005
ovarian cancer 1.300 0.000
Breast cancer 1.200 0.000
Gaucher disease type 1 -1.100 0.049
cystic fibrosis and chronic rhinosinusit... 1.007 0.023
dermatomyositis -1.100 0.018

Gene RIF (8)

PMID Text
25739453 Homer3 acts as a scaffold that spatially organizes actin assembly to support neutrophil polarity and motility downstream of GPCR activation.
24792907 Interaction of the protein with amyloid precursor protein is regulated by calcium homeostasis.
23725168 Loss of Homer3 is associated with acute myeloid leukemia.
20693425 Homer3 specifically associates with a novel ubiquitin-like domain in the I kappa B kinase (IKK) beta subunit of the IKK complex.
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
16979624 Fat1 exhibit co-localisation with Homer-3 in cellular protrusions and at the plasma membrane of HeLa cells
14645007 Homer-3 may be involved in the regulation of SRE activation in T cells via interaction between its EVH1 domain and C/EBP beta.
12815733 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF      1 - 70
TKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPALGLASHQVPP     71 - 140
SPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAA    141 - 210
AQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGG    211 - 280
PREALEAAEREETQQKVQDLETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELR    281 - 350
EGLARLAEAAP                                                               351 - 361
//

Text Mined References (22)

PMID Year Title
25739453 2015 Homer3 regulates the establishment of neutrophil polarity.
24792907 2014 Calcium regulates the interaction of amyloid precursor protein with Homer3 protein.
23725168 2013 Growth and differentiation effects of Homer3 on a leukemia cell line.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20693425 2010 Cutting edge: association with I kappa B kinase beta regulates the subcellular localization of Homer3.
19345194 2009 The postsynaptic density proteins Homer and Shank form a polymeric network structure.
19060904 2009 An empirical framework for binary interactome mapping.
18387811 2008 Homer2 and Homer3 interact with amyloid precursor protein and inhibit Abeta production.
18218901 2008 NFAT binding and regulation of T cell activation by the cytoplasmic scaffolding Homer proteins.
16979624 2006 The intracellular domain of the human protocadherin hFat1 interacts with Homer signalling scaffolding proteins.
More...